Trypsin Active Protein | ANASTE_00397 active protein
Recombinant Porcine Trypsin
Synonyms
Trypsin; N/A; Recombinant Porcine Trypsin; Trypsin Porcine; Trypsin Porcine Recombinant; pTrypsin; ANASTE_00397 active protein
Form/Format
The Porcine Trypsin was lyophilized with mannitol as preservative.!!Soulubility||It is recommended to reconstitute the lyophilized Porcine Trypsin in sterile 1mM HCl or 50mM HAC not less than 100µg/ml, which can then be further diluted to other aqueous so
Sequence
VGGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYKSRIQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSRVATVSLPRSCAAAGTECLISGWGNTKSSGSSYPSLLQCLKAPVLSDSSCKSSYPGQITGNMICVGFLEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCAQKNKPGVYTKVCNYVNWIQQTIAAN
Sequence Length
382
Source
E. coli
Physical Appearance
Sterile Filtered lyophilized powder.
Biological Activity
4500 USP units/mg protein.
Unit Definition
One USP unit of trypsin activity will produce a Delta A253 of 0.003 per minute in a reaction volume of 3.0ml at pH7.6 and 25°C, with BAEE as a substrate (1cm light path).
Preparation and Storage
Recombinant Porcine Trypsin although stable at room temp for 1 week, should be stored desiccated below -18°C.
For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Please prevent freeze-thaw cycles.
For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Please prevent freeze-thaw cycles.
Related Product Information for ANASTE_00397 active protein
Description: Recombinant Porcine Trypsin is expressed in E.coli and purified by standard chromatography techniques.
Product Categories/Family for ANASTE_00397 active protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI Official Full Name
trypsin
UniProt Protein Name
Trypsin
UniProt Gene Name
ANASTE_00397
UniProt Entry Name
B1C6Q1_9FIRM
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The Trypsin anaste_00397 (Catalog #AAA38947) is an Active Protein and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: VGGYTCAANS IPYQVSLNSG SHFCGGSLIN SQWVVSAAHC YKSRIQVRLG EHNIDVLEGN EQFINAAKII THPNFNGNTL DNDIMLIKLS SPATLNSRVA TVSLPRSCAA AGTECLISGW GNTKSSGSSY PSLLQCLKAP VLSDSSCKSS YPGQITGNMI CVGFLEGGKD SCQGDSGGPV VCNGQLQGIV SWGYGCAQKN KPGVYTKVCN YVNWIQQTIA AN. It is sometimes possible for the material contained within the vial of "Trypsin, Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.