Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us

A disintegrin and metalloproteinase with thrombospondin motifs 13 (Adamts13) Recombinant Protein | Adamts13 recombinant protein

Recombinant Mouse A disintegrin and metalloproteinase with thrombospondin motifs 13 (Adamts13) , partial

Gene Names
Adamts13; Gm710; vWF-CP; ADAM-TS13; ADAMTS-13
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
A disintegrin and metalloproteinase with thrombospondin motifs 13 (Adamts13); N/A; Recombinant Mouse A disintegrin and metalloproteinase with thrombospondin motifs 13 (Adamts13) , partial; Adamts13 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
904-1137aa; partial
Sequence
WTPLVGLCSISCGRGLKELYFLCMDSVLKMPVQEELCGLASKPPSRWEVCRARPCPARWETQVLAPCPVTCGGGRVPLSVRCVQLDRGHPISVPHSKCSPVPKPGSFEDCSPEPCPARWKVLSLGPCSASCGLGTATQMVACMQLDQGHDNEVNETFCKALVRPQASVPCLIADCAFRWHISAWTECSVSCGDGIQRRHDTCLGPQAQVPVPANFCQHLPKPMTVRGCWAGPCA
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Adamts13 recombinant protein
This gene encodes a member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motif) protein family. Members of the family share several distinct protein modules, including a propeptide region, a metalloproteinase domain, a disintegrin-like domain, and a thrombospondin type 1 (TS) motif. Individual members of this family differ in the number of C-terminal TS motifs, and some have unique C-terminal domains. The enzyme encoded by this gene is the von Willebrand Factor (vWF)-cleaving protease, which is responsible for cleaving at the site of Tyr842-Met843 of the vWF molecule. A deficiency of this enzyme is associated with thrombotic thrombocytopenic purpura. Alternative splicing of this gene generates multiple transcript variants encoding different isoforms.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
32.7 kDa
NCBI Official Full Name
A disintegrin and metalloproteinase with thrombospondin motifs 13 isoform 1 preproprotein
NCBI Official Synonym Full Names
a disintegrin-like and metallopeptidase (reprolysin type) with thrombospondin type 1 motif, 13
NCBI Official Symbol
Adamts13
NCBI Official Synonym Symbols
Gm710; vWF-CP; ADAM-TS13; ADAMTS-13
NCBI Protein Information
A disintegrin and metalloproteinase with thrombospondin motifs 13
UniProt Protein Name
A disintegrin and metalloproteinase with thrombospondin motifs 13
UniProt Gene Name
Adamts13
UniProt Synonym Gene Names
Gm710; ADAM-TS 13; ADAM-TS13; ADAMTS-13; vWF-CP; vWF-cleaving protease

Similar Products

Product Notes

The Adamts13 adamts13 (Catalog #AAA117152) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 904-1137aa; partial. The amino acid sequence is listed below: WTPLVGLCSI SCGRGLKELY FLCMDSVLKM PVQEELCGLA SKPPSRWEVC RARPCPARWE TQVLAPCPVT CGGGRVPLSV RCVQLDRGHP ISVPHSKCSP VPKPGSFEDC SPEPCPARWK VLSLGPCSAS CGLGTATQMV ACMQLDQGHD NEVNETFCKA LVRPQASVPC LIADCAFRWH ISAWTECSVS CGDGIQRRHD TCLGPQAQVP VPANFCQHLP KPMTVRGCWA GPCA. It is sometimes possible for the material contained within the vial of "A disintegrin and metalloproteinase with thrombospondin motifs 13 (Adamts13), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.