Vasopressin V2 receptor (AVPR2) Recombinant Protein | AVPR2 recombinant protein
Recombinant Pig Vasopressin V2 receptor (AVPR2)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Vasopressin V2 receptor (AVPR2); N/A; Recombinant Pig Vasopressin V2 receptor (AVPR2); Recombinant Vasopressin V2 receptor (AVPR2); Vasopressin V2 receptor; V2R; AVPR V2 Antidiuretic hormone receptor Renal-type arginine vasopressin receptor; AVPR2 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence
WSVWDPKAPREGPPFVLLMLLASLNSCTNPWIYASFSSSISSELRSLLCCPRRRTPPSLRPQEESCATASSFSARDTSS
Species
Sus scrofa (Pig)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
Related Product Information for AVPR2 recombinant protein
Receptor for arginine vasopressin. The activity of this receptor is mediated by G proteins which activate adenylate cyclase (PubMed:8393786). Involved in renal water reabsorption (By similarity).
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
24.7 kDa
NCBI Official Full Name
vasopressin V2 receptor
NCBI Official Symbol
AVPR2
NCBI Protein Information
vasopressin V2 receptor; V2R; AVPR V2; antidiuretic hormone receptor; V-2 lysine vasopressin receptor; renal-type arginine vasopressin receptor; arginine vasopressin receptor 2 (nephrogenic diabetes insipidus)
UniProt Protein Name
Vasopressin V2 receptor
UniProt Gene Name
AVPR2
UniProt Synonym Gene Names
V2R
UniProt Entry Name
V2R_PIG
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The AVPR2 avpr2 (Catalog #AAA115025) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: WSVWDPKAPR EGPPFVLLML LASLNSCTNP WIYASFSSSI SSELRSLLCC PRRRTPPSLR PQEESCATAS SFSARDTSS. It is sometimes possible for the material contained within the vial of "Vasopressin V2 receptor (AVPR2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
