Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA200940_WB11.jpg WB (Western Blot) (WB Suggested Anti-AVPR2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Hela cell lysate)

Rabbit AVPR2 Polyclonal Antibody | anti-AVPR2 antibody

AVPR2 antibody - C-terminal region

Gene Names
AVPR2; DI1; DIR; NDI; V2R; ADHR; DIR3
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Applications
Western Blot
Purity
Affinity Purified
Synonyms
AVPR2, Antibody; AVPR2 antibody - C-terminal region; anti-AVPR2 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: NPWIYASFSSSVSSELRSLLCCARGRTPPSLGPQDESCTTASSSLAKDTS
Sequence Length
371
Applicable Applications for anti-AVPR2 antibody
WB (Western Blot)
Homology
Cow: 79%; Dog: 79%; Guinea Pig: 100%; Horse: 86%; Human: 100%; Mouse: 93%; Rabbit: 86%; Rat: 93%; Sheep: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human AVPR2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-AVPR2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Hela cell lysate)

product-image-AAA200940_WB11.jpg WB (Western Blot) (WB Suggested Anti-AVPR2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Hela cell lysate)

WB (Western Blot)

(Host: RabbitTarget Name: AVPR2Sample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

product-image-AAA200940_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: AVPR2Sample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: AVPR2Sample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)

product-image-AAA200940_WB15.jpg WB (Western Blot) (Host: RabbitTarget Name: AVPR2Sample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-AVPR2 antibody
This is a rabbit polyclonal antibody against AVPR2. It was validated on Western Blot

Target Description: This gene encodes the vasopressin receptor, type 2, also known as the V2 receptor, which belongs to the seven-transmembrane-domain G protein-coupled receptor (GPCR) superfamily, and couples to Gs thus stimulating adenylate cyclase. The subfamily that includes the V2 receptor, the V1a and V1b vasopressin receptors, the oxytocin receptor, and isotocin and mesotocin receptors in non-mammals, is well conserved, though several members signal via other G proteins. All bind similar cyclic nonapeptide hormones. The V2 receptor is expressed in the kidney tubule, predominantly in the distal convoluted tubule and collecting ducts, where its primary property is to respond to the pituitary hormone arginine vasopressin (AVP) by stimulating mechanisms that concentrate the urine and maintain water homeostasis in the organism. When the function of this gene is lost, the disease Nephrogenic Diabetes Insipidus (NDI) results. The V2 receptor is also expressed outside the kidney although its tissue localization is uncertain. When these 'extrarenal receptors' are stimulated by infusion of a V2 selective agonist (dDAVP), a variety of clotting factors are released into the bloodstream. The physiologic importance of this property is not known - its absence does not appear to be detrimental in NDI patients. The gene expression has also been described in fetal lung tissue and lung cancer associated with alternative splicing.
Product Categories/Family for anti-AVPR2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
554
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
40kDa
NCBI Official Full Name
vasopressin V2 receptor isoform 1
NCBI Official Synonym Full Names
arginine vasopressin receptor 2
NCBI Official Symbol
AVPR2
NCBI Official Synonym Symbols
DI1; DIR; NDI; V2R; ADHR; DIR3
NCBI Protein Information
vasopressin V2 receptor
UniProt Protein Name
Vasopressin V2 receptor
UniProt Gene Name
AVPR2
UniProt Synonym Gene Names
ADHR; DIR; DIR3; V2R; V2R
UniProt Entry Name
V2R_HUMAN

Similar Products

Product Notes

The AVPR2 avpr2 (Catalog #AAA200940) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The AVPR2 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's AVPR2 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the AVPR2 avpr2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: NPWIYASFSS SVSSELRSLL CCARGRTPPS LGPQDESCTT ASSSLAKDTS. It is sometimes possible for the material contained within the vial of "AVPR2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.