Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us

Complement C1q subcomponent subunit A Recombinant Protein | C1QA recombinant protein

Recombinant mouse Complement C1q subcomponent subunit A

Gene Names
C1qa; C1q; AI255395
Purity
Greater than 90% as determined by SDS-PAGE.
Synonyms
Complement C1q subcomponent subunit A; N/A; Recombinant mouse Complement C1q subcomponent subunit A; C1QA recombinant protein
Ordering
Host
Yeast
Purity/Purification
Greater than 90% as determined by SDS-PAGE.
Form/Format
20mM Tris-HCl based buffer, pH8.0
Sequence Positions
23-245aa
Sequence
EDVCRAPNGKDGAPGNPGRPGRPGLKGERGEPGAAGIRTGIRGFKGDPGESGPPGKPGNVGLPGPSGPLGDSGPQGLKGVKGNPGNIRDQPRPAFSAIRQNPMTLGNVVIFDKVLTNQESPYQNHTGRFICAVPGFYYFNFQVISKWDLCLFIKSSSGGQPRDSLSFSNTNNKGLFQVLAGGTVLQLRRGDEVWIEKDPAKGRIYQGTEADSIFSGFLIFPSA
Tag Info
His-tag
Calculated MW
25.kD
Target Species
Mouse
Preparation and Storage
Store at -20°C, for extended storage, conserve at -20°C or -80°C. Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Related Product Information for C1QA recombinant protein
Recombinant protein

C1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complent syst. The collagen-like regions of C1q interact with the Ca2+-dependent C1r2C1s2 proenzyme complex, and efficient activation of C1 takes place on interaction of the globular heads of C1q with the Fc regions of IgG or IgM antibody present in immune complexes.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
25.5kD
NCBI Official Full Name
complement C1q subcomponent subunit A
NCBI Official Synonym Full Names
complement component 1, q subcomponent, alpha polypeptide
NCBI Official Symbol
C1qa
NCBI Official Synonym Symbols
C1q; AI255395
NCBI Protein Information
complement C1q subcomponent subunit A
UniProt Protein Name
Complement C1q subcomponent subunit A
UniProt Gene Name
C1qa

Similar Products

Product Notes

The C1QA c1qa (Catalog #AAA309772) is a Recombinant Protein produced from Yeast and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 23-245aa. The amino acid sequence is listed below: EDVCRAPNGK DGAPGNPGRP GRPGLKGERG EPGAAGIRTG IRGFKGDPGE SGPPGKPGNV GLPGPSGPLG DSGPQGLKGV KGNPGNIRDQ PRPAFSAIRQ NPMTLGNVVI FDKVLTNQES PYQNHTGRFI CAVPGFYYFN FQVISKWDLC LFIKSSSGGQ PRDSLSFSNT NNKGLFQVLA GGTVLQLRRG DEVWIEKDPA KGRIYQGTEA DSIFSGFLIF PSA. It is sometimes possible for the material contained within the vial of "Complement C1q subcomponent subunit A, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.