Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA113137_SDS_PAGE15.jpg SDS-PAGE

H-2 class II histocompatibility antigen gamma chain Recombinant Protein | Cd74 recombinant protein

Recombinant Rat H-2 class II histocompatibility antigen gamma chain

Average rating 0.0
No ratings yet
Gene Names
Cd74; INVG34
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
H-2 class II histocompatibility antigen gamma chain; N/A; Recombinant Rat H-2 class II histocompatibility antigen gamma chain; Ia antigen-associated invariant chain; IiMHC class II-associated invariant chain; CD74; Cd74 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
57-280aa; Extracellular Domain
Sequence
QQQGRLDKLTVTSQNLQLENLRMKLPKSAKPVSPMRMATPLLMRPLSMDNMLQAPVKNVTKYGNMTQDHVMHLLTKSGPVNYPQLKGSFPENLKHLKNSMNGLDWKVFESWMKQWLLFEMSKNSLEEKQPTQTPPKVLTKCQEEVSHIPDVHPGAFRPKCDENGNYMPLQCHGSTGYCWCVFPNGTEVPHTKSRGRHNCSEPLDMEDPSSGLGVTKQDMGQMFL
Sequence Length
216
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

product-image-AAA113137_SDS_PAGE15.jpg SDS-PAGE
Related Product Information for Cd74 recombinant protein
Plays a critical role in MHC class II antigen processing by stabilizing peptide-free class II alpha/beta heterodimers in a complex soon after their synthesis and directing transport of the complex from the endoplasmic reticulum to compartments where peptide loading of class II takes place.
References
Sequence of a rat MHC class II-associated invariant chain cDNA clone containing a 64 amino acid thyroglobulin-like domain.McKnight A.J., Mason D.W., Barclay A.N.Nucleic Acids Res. 17:3983-3984(1989) Nucleotide sequence of rat invariant gamma chain cDNA clone pLR gamma 34.3.Henkes W., Syha J., Reske K.Nucleic Acids Res. 16:11822-11822(1988)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
29.5 kDa
NCBI Official Full Name
H-2 class II histocompatibility antigen gamma chain
NCBI Official Synonym Full Names
CD74 molecule
NCBI Official Symbol
Cd74
NCBI Official Synonym Symbols
INVG34
NCBI Protein Information
H-2 class II histocompatibility antigen gamma chain
UniProt Protein Name
H-2 class II histocompatibility antigen gamma chain
UniProt Gene Name
Cd74
UniProt Synonym Gene Names
Ii
UniProt Entry Name
HG2A_RAT

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The Cd74 cd74 (Catalog #AAA113137) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 57-280aa; Extracellular Domain. The amino acid sequence is listed below: QQQGRLDKLT VTSQNLQLEN LRMKLPKSAK PVSPMRMATP LLMRPLSMDN MLQAPVKNVT KYGNMTQDHV MHLLTKSGPV NYPQLKGSFP ENLKHLKNSM NGLDWKVFES WMKQWLLFEM SKNSLEEKQP TQTPPKVLTK CQEEVSHIPD VHPGAFRPKC DENGNYMPLQ CHGSTGYCWC VFPNGTEVPH TKSRGRHNCS EPLDMEDPSS GLGVTKQDMG QMFL. It is sometimes possible for the material contained within the vial of "H-2 class II histocompatibility antigen gamma chain, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.