H-2 class II histocompatibility antigen gamma chain Recombinant Protein | Cd74 recombinant protein
Recombinant Mouse H-2 class II histocompatibility antigen gamma chain
Gene Names
Cd74; Ii; CLIP; DHLAG; HLADG; Ia-GAMMA
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
H-2 class II histocompatibility antigen gamma chain; N/A; Recombinant Mouse H-2 class II histocompatibility antigen gamma chain; Ia antigen-associated invariant chain; IiMHC class II-associated invariant chain; CD74; Cd74 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
56-279aa; Extracellular Domain
Sequence
QQQGRLDKLTITSQNLQLESLRMKLPKSAKPVSQMRMATPLLMRPMSMDNMLLGPVKNVTKYGNMTQDHVMHLLTRSGPLEYPQLKGTFPENLKHLKNSMDGVNWKIFESWMKQWLLFEMSKNSLEEKKPTEAPPKVLTKCQEEVSHIPAVYPGAFRPKCDENGNYLPLQCHGSTGYCWCVFPNGTEVPHTKSRGRHNCSEPLDMEDLSSGLGVTRQELGQVTL
Sequence Length
215
Production Note
Special Offer: The E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our or email to for more details.
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Related Product Information for Cd74 recombinant protein
Plays a critical role in MHC class II antigen processing by stabilizing peptide-free class II alpha/beta heterodimers in a complex soon after their synthesis and directing transport of the complex from the endoplasmic reticulum to compartments where peptide loading of class II takes place.
References
Primary structure of the gene for the murine Ia antigen-associated invariant chains (Ii) . An alternatively spliced exon encodes a cysteine-rich domain highly homologous to a repetitive sequence of thyroglobulin.Koch N., Lauer W., Habicht J., Dobberstein B.EMBO J. 6:1677-1683(1987) Complete sequence of the murine invariant chain (Ii) gene.Zhu L., Jones P.P.Nucleic Acids Res. 17:447-448(1989) Nucleotide sequences of the murine Ia-associated invariant chain (Ii) and I-E (H-2S, Beta) chain expressible cDNA clones.Stone J., Perry R., Todd J.A., McDevitt H.O. The IFN-gamma response of the murine invariant chain gene is mediated by a complex enhancer that includes several MHC class II consensus elements.Eades A.-M., Litfin M., Rahmsdorf H.J.J. Immunol. 144:4399-4409(1990) Structure of the murine Ia-associated invariant (Ii) chain as deduced from a cDNA clone.Singer P.A., Lauer W., Dembic Z., Mayer W.E., Lipp J., Koch N., Hammerling G., Klein J., Dobberstein B.EMBO J. 3:873-877(1984) Identification of the glycosaminoglycan-attachment site of mouse invariant-chain proteoglycan core protein by site-directed mutagenesis.Miller J., Hatch J.A., Simonis S., Cullen S.E.Proc. Natl. Acad. Sci. U.S.A. 85:1359-1363(1988) The phagosomal proteome in interferon-gamma-activated macrophages.Trost M., English L., Lemieux S., Courcelles M., Desjardins M., Thibault P.Immunity 30:143-154(2009)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
29.4 kDa
NCBI Official Full Name
H-2 class II histocompatibility antigen gamma chain isoform 1
NCBI Official Synonym Full Names
CD74 antigen (invariant polypeptide of major histocompatibility complex, class II antigen-associated)
NCBI Official Symbol
Cd74
NCBI Official Synonym Symbols
Ii; CLIP; DHLAG; HLADG; Ia-GAMMA
NCBI Protein Information
H-2 class II histocompatibility antigen gamma chain
UniProt Protein Name
H-2 class II histocompatibility antigen gamma chain
UniProt Gene Name
Cd74
UniProt Synonym Gene Names
Ii; Ii
UniProt Entry Name
HG2A_MOUSE
Similar Products
Product Notes
The Cd74 cd74 (Catalog #AAA113359) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 56-279aa; Extracellular Domain. The amino acid sequence is listed below: QQQGRLDKLT ITSQNLQLES LRMKLPKSAK PVSQMRMATP LLMRPMSMDN MLLGPVKNVT KYGNMTQDHV MHLLTRSGPL EYPQLKGTFP ENLKHLKNSM DGVNWKIFES WMKQWLLFEM SKNSLEEKKP TEAPPKVLTK CQEEVSHIPA VYPGAFRPKC DENGNYLPLQ CHGSTGYCWC VFPNGTEVPH TKSRGRHNCS EPLDMEDLSS GLGVTRQELG QVTL. It is sometimes possible for the material contained within the vial of "H-2 class II histocompatibility antigen gamma chain, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
