CD81 antigen (CD81) Recombinant Protein | CD81 recombinant protein
Recombinant Human CD81 antigen (CD81), partial
Gene Names
CD81; S5.7; CVID6; TAPA1; TSPAN28
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
CD81 antigen (CD81); N/A; Recombinant Human CD81 antigen (CD81), partial; 26 kDa cell surface protein TAPA-1; Target of the antiproliferative antibody 1; Tetraspanin-28; Tspan-28; CD81; CD81 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
113-201aa; partial
Sequence
FVNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSNIISNLFKEDCHQKIDDLFSGK
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Related Product Information for CD81 recombinant protein
May play an important role in the regulation of lymphoma cell growth. Interacts with a 16-kDa Leu-13 protein to form a complex possibly involved in signal transduction. May act as the viral receptor for HCV.
Product Categories/Family for CD81 recombinant protein
References
TAPA-1, the target of an antiproliferative antibody, defines a new family of transmembrane proteins.Oren R., Takahashi S., Doss C., Levy R., Levy S.Mol. Cell. Biol. 10:4007-4015(1990)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
38.7
NCBI Official Full Name
CD81 antigen isoform 2
NCBI Official Synonym Full Names
CD81 molecule
NCBI Official Symbol
CD81
NCBI Official Synonym Symbols
S5.7; CVID6; TAPA1; TSPAN28
NCBI Protein Information
CD81 antigen
UniProt Protein Name
CD81 antigen
UniProt Gene Name
CD81
UniProt Synonym Gene Names
TAPA1; TSPAN28; Tspan-28
UniProt Entry Name
CD81_HUMAN
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The CD81 cd81 (Catalog #AAA18469) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 113-201aa; partial. The amino acid sequence is listed below: FVNKDQIAKD VKQFYDQALQ QAVVDDDANN AKAVVKTFHE TLDCCGSSTL TALTTSVLKN NLCPSGSNII SNLFKEDCHQ KIDDLFSGK . It is sometimes possible for the material contained within the vial of "CD81 antigen (CD81), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
