Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us

Cyclin-dependent kinase 5 activator 1 (Cdk5r1) Recombinant Protein | Cdk5r1 recombinant protein

Recombinant Mouse Cyclin-dependent kinase 5 activator 1 (Cdk5r1)

Gene Names
Cdk5r1; p25; p35; Cdk5r; D11Bwg0379e
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Cyclin-dependent kinase 5 activator 1 (Cdk5r1); N/A; Recombinant Mouse Cyclin-dependent kinase 5 activator 1 (Cdk5r1); Cdk5r1 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-307aa; Full Length of Mature Protein
Sequence
GTVLSLSPSYRKATLFEDGAATVGHYTAVQNSKNAKDKNLKRHSIISVLPWKRIVAVSAKKKNSKKAQPNSSYQSNIAHLNNENLKKSLSCANLSTFAQPPPAQPPAPPASQLSGSQTGVSSSVKKAPHPAITSAGTPKRVIVQASTSELLRCLGEFLCRRCYRLKHLSPTDPVLWLRSVDRSLLLQGWQDQGFITPANVVFLYMLCRDVISSEVGSDHELQAVLLTCLYLSYSYMGNEISYPLKPFLVESCKEAFWDRCLSVINLMSSKMLQINADPHYFTQVFSDLKNESGQEDKKRLLLGLDR
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Cdk5r1 recombinant protein
This protein (p35) is a neuron-specific activator of cyclin-dependent kinase 5 (CDK5); the activation of CDK5 is required for proper development of the central nervous system. The p35 form of this protein is proteolytically cleaved by calpain, generating a p25 form. The cleavage of p35 into p25 results in relocalization of the protein from the cell periphery to nuclear and perinuclear regions. P25 deregulates CDK5 activity by prolonging its activation and changing its cellular location. The p25 form accumulates in the brain neurons of patients with Alzheimer s disease. This accumulation correlates with an increase in CDK5 kinase activity, and may lead to aberrantly phosphorylated forms of the microtubule-associated protein tau, which contributes to Alzheimer s disease.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34,031 Da
NCBI Official Full Name
cyclin-dependent kinase 5 activator 1
NCBI Official Synonym Full Names
cyclin-dependent kinase 5, regulatory subunit 1 (p35)
NCBI Official Symbol
Cdk5r1
NCBI Official Synonym Symbols
p25; p35; Cdk5r; D11Bwg0379e
NCBI Protein Information
cyclin-dependent kinase 5 activator 1
UniProt Protein Name
Cyclin-dependent kinase 5 activator 1
UniProt Gene Name
Cdk5r1
UniProt Synonym Gene Names
Cdk5r; Nck5a; CDK5 activator 1; p35; p25; p23

Similar Products

Product Notes

The Cdk5r1 cdk5r1 (Catalog #AAA113716) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-307aa; Full Length of Mature Protein. The amino acid sequence is listed below: GTVLSLSPSY RKATLFEDGA ATVGHYTAVQ NSKNAKDKNL KRHSIISVLP WKRIVAVSAK KKNSKKAQPN SSYQSNIAHL NNENLKKSLS CANLSTFAQP PPAQPPAPPA SQLSGSQTGV SSSVKKAPHP AITSAGTPKR VIVQASTSEL LRCLGEFLCR RCYRLKHLSP TDPVLWLRSV DRSLLLQGWQ DQGFITPANV VFLYMLCRDV ISSEVGSDHE LQAVLLTCLY LSYSYMGNEI SYPLKPFLVE SCKEAFWDRC LSVINLMSSK MLQINADPHY FTQVFSDLKN ESGQEDKKRL LLGLDR. It is sometimes possible for the material contained within the vial of "Cyclin-dependent kinase 5 activator 1 (Cdk5r1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.