Form/Format
Each vial contains 2 ~ 3 x 10^6 cells in 1 ml of 90% FBS + 10% DMSO.
Sequence Positions
hICOSL (accession number NM_015259)
Sequence
MRLGSPGLLFLLFSSLRADTQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESK
TVVTYHIPQNSSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSL
GFQEVLSVEVTLHVAANFSVPVVSAPHSPSQDELTFTCTSINGYPRPNVYWINKTDNSLL
DQALQNDTVFLNMRGLYDVVSVLRIARTPSVNIGCCIENVLLQQNLTVGSQTGNDIGERD
KITENPVSTGEKNAATWSILAVLCLLVVVAVAIGWVCRDRCLQHSYAGAWAVSPETELTG
HV
Applicable Applications for ICOSL cell line
WB (Western Blot), ICC (Immunocytochemistry), FCM/FACS (Flow Cytometry)
Culture conditions
Cells should be grown at 37°C with 5% CO2 using DMEM medium (w/ L-Glutamine, 4.5g/L Glucose and Sodium Pyruvate) supplemented with 10% heat-inactivated FBS supplemented with 10% FBS and 1% Pen/Strep, plus 10 ?g/ml of Blasticidin. It is recommended to quickly thaw the frozen cells upon receipt or from liquid nitrogen in a 37oC water-bath, transfer to a tube containing 10 ml of growth medium without Blasticidin, spin down cells, resuspend cells in pre-warmed growth medium without Blasticidin, transfer resuspended cells to T25 flask and culture in 37oC-CO2 incubator. Leave the T25 flask in the incubator for 1~2 days without disturbing or changing the medium until cells completelyrecover viability and become adherent. Once cells are over 90% adherent, remove growth medium and passage the cells through trypsinization and centrifugation. At first passage, switch to growth medium containing Blasticidin. Cells should be split before they reach complete confluence. To passage the cells, detach cells from culture vessel with Trypsin/EDTA, add complete growth medium and transfer to a tube, spin down cells, resuspend cells and seed appropriate aliquots of cells suspension into new culture vessels. Subcultivation ration = 1:10 to 1:20 weekly. To achieve satisfactory results, cells should not be passaged over 16 times.
Dry Ice Note
The product may be shipped with dry ice, and an additional fee may be added to your shipping cost.
Preparation and Storage
Immediately upon receipt, store in liquid nitrogen.
Dry Ice Shipment: Extra charge fee may add to your shipping cost as dry ice is required to ship this product.
Shipping Note: Product is available for shipment in the United States, Canada and European countries. Please inquire for shipment to other countries.
Dry Ice Shipment: Extra charge fee may add to your shipping cost as dry ice is required to ship this product.
Shipping Note: Product is available for shipment in the United States, Canada and European countries. Please inquire for shipment to other countries.
Related Product Information for ICOSL cell line
ICOSL Stable Cell Line is a stably transfected CHO-K1 cell line which expresses human ICOS Ligand (ICOSL, also known as B7-H2, B7RP-1, and CD275).
Product Categories/Family for ICOSL cell line
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
NCBI Official Full Name
ICOS ligand isoform d
NCBI Official Synonym Full Names
inducible T-cell costimulator ligand
NCBI Official Symbol
ICOSLG
NCBI Official Synonym Symbols
B7H2; GL50; B7-H2; B7RP1; CD275; ICOSL; LICOS; B7RP-1; ICOS-L
NCBI Protein Information
ICOS ligand
UniProt Protein Name
ICOS ligand
UniProt Gene Name
ICOSLG
UniProt Synonym Gene Names
B7H2; B7RP1; ICOSL; KIAA0653; B7-H2; B7RP-1
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The ICOSL icoslg (Catalog #AAA78374) is a Cell Line and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is hICOSL (accession number NM_015259). AAA Biotech's ICOSL can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), ICC (Immunocytochemistry), FCM/FACS (Flow Cytometry). Researchers should empirically determine the suitability of the ICOSL icoslg for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MRLGSPGLLF LLFSSLRADT QEKEVRAMVG SDVELSCACP EGSRFDLNDV YVYWQTSESK TVVTYHIPQ NSSLENVDSR YRNRALMSPA GMLRGDFSLR LFNVTPQDEQ KFHCLVLSQS L GFQEVLSV EVTLHVAANF SVPVVSAPHS PSQDELTFTC TSINGYPRPN VYWINKTDNS LL DQALQND TVFLNMRGLY DVVSVLRIAR TPSVNIGCCI ENVLLQQNLT VGSQTGNDIG ERD KITENP VSTGEKNAAT WSILAVLCLL VVVAVAIGWV CRDRCLQHSY AGAWAVSPET ELTG HV. It is sometimes possible for the material contained within the vial of "ICOSL, Cell Line" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
