ICOSL cell line

ICOSL Stable Cell Line

Cat. Num. AAA78374

• Gene Names: ICOSLG; B7H2; GL50; B7-H2; B7RP1; CD275; ICOSL; LICOS; B7RP-1; ICOS-L
• Applications: Western Blot, Immunocytochemistry, Flow Cytometry, Functional Assay
• Synonyms: ICOSL; N/A; ICOSL Stable Cell Line; ICOSL cell line

• Form/Format: Each vial contains 2 ~ 3 x 10^6 cells in 1 ml of 90% FBS + 10% DMSO.
• Sequence Positions: hICOSL (accession number NM_015259)
• Sequence: MRLGSPGLLFLLFSSLRADTQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESK TVVTYHIPQNSSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSL GFQEVLSVEVTLHVAANFSVPVVSAPHSPSQDELTFTCTSINGYPRPNVYWINKTDNSLL DQALQNDTVFLNMRGLYDVVSVLRIARTPSVNIGCCIENVLLQQNLTVGSQTGNDIGERD KITENPVSTGEKNAATWSILAVLCLLVVVAVAIGWVCRDRCLQHSYAGAWAVSPETELTG HV

• Applicable Applications for ICOSL cell line: WB (Western Blot), ICC (Immunocytochemistry), FCM/FACS (Flow Cytometry)
• Culture conditions: Cells should be grown at 37°C with 5% CO2 using DMEM medium (w/ L-Glutamine, 4.5g/L Glucose and Sodium Pyruvate) supplemented with 10% heat-inactivated FBS supplemented with 10% FBS and 1% Pen/Strep, plus 10 ?g/ml of Blasticidin. It is recommended to quickly thaw the frozen cells upon receipt or from liquid nitrogen in a 37oC water-bath, transfer to a tube containing 10 ml of growth medium without Blasticidin, spin down cells, resuspend cells in pre-warmed growth medium without Blasticidin, transfer resuspended cells to T25 flask and culture in 37oC-CO2 incubator. Leave the T25 flask in the incubator for 1~2 days without disturbing or changing the medium until cells completelyrecover viability and become adherent. Once cells are over 90% adherent, remove growth medium and passage the cells through trypsinization and centrifugation. At first passage, switch to growth medium containing Blasticidin. Cells should be split before they reach complete confluence. To passage the cells, detach cells from culture vessel with Trypsin/EDTA, add complete growth medium and transfer to a tube, spin down cells, resuspend cells and seed appropriate aliquots of cells suspension into new culture vessels. Subcultivation ration = 1:10 to 1:20 weekly. To achieve satisfactory results, cells should not be passaged over 16 times.
• Dry Ice Shipment: Extra charge fee may add to your shipping cost as dry ice is required to ship this product.
• Preparation and Storage: Immediately upon receipt, store in liquid nitrogen.; ; Dry Ice Shipment: Extra charge fee may add to your shipping cost as dry ice is required to ship this product.; ; Shipping Note: Product is available for shipment in the United States, Canada and European countries. Please inquire for shipment to other countries.

Application Data

(Fig-1: Detection of human ICOSL in the CHO-K1/ICOSL stable cell line by Flow Cytometry. CHO-K1 cells (Green); CHO-K1/ICOSL cells (Red).)

Related Product Information for ICOSL cell line

ICOSL Stable Cell Line is a stably transfected CHO-K1 cell line which expresses human ICOS Ligand (ICOSL, also known as B7-H2, B7RP-1, and CD275).

Product Categories/Family for ICOSL cell line

Cell Lines; Stable Cell Lines

NCBI and Uniprot Product Information

• NCBI GI #: 545688894
• NCBI GeneID: 23308
• NCBI Accession #: NP_001269981.1
• NCBI GenBank Nucleotide #: NM_001283052.1
• NCBI Official Full Name: ICOS ligand isoform d
• NCBI Official Synonym Full Names: inducible T-cell costimulator ligand
• NCBI Official Symbol: ICOSLG
• NCBI Official Synonym Symbols: B7H2; GL50; B7-H2; B7RP1; CD275; ICOSL; LICOS; B7RP-1; ICOS-L
• NCBI Protein Information: ICOS ligand
• UniProt Protein Name: ICOS ligand
• UniProt Gene Name: ICOSLG
• UniProt Synonym Gene Names: B7H2; B7RP1; ICOSL; KIAA0653; B7-H2; B7RP-1