Chromogranin-A (CHGA) Recombinant Protein | CHGA recombinant protein
Recombinant Pig Chromogranin-A (CHGA)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Chromogranin-A (CHGA); N/A; Recombinant Pig Chromogranin-A (CHGA); CHGA recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
17-446, Full length protein
Sequence
LPVNSPMNKGDTEVMKCIVEVISDTLSKPSPMPVSQECFETLRGDERILSILRHQNLLKELQDLALQGAKERSHQQKKQSSYEDELSEVLEKQNDQAELKEGTEEASSKEAAEKRGDSKEVEKNDEDADGAKPQASLEPPXXXEAEDQTPGEEEAASTHPLASLPSKKRPGAQAEEDHEGPSQGPVDREKGPSAEQGPQAEREEEEEAEAGEKAVPEEEGPRSEAFDSHPSLGYKEMQRGWPQAPAMDGAGKTGAEEAQPPEGKGAREHSRQEEEEETAGAPQGLFRGGKRGEPAQEEEERLSEEWENAKRWSKMDRLAKELTAEKRLQGEEEEEEEEEDPDRSMKLSFRAPAYGFRGPGLQLRRGWRPSSREDSVEAGLPLQVRXYLEEKKEEEGSANRRPEDQELESLSAIEAELEKVAPQLQSLRRG
Sequence Length
430
Species
Sus scrofa (Pig)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for CHGA recombinant protein
This protein is a member of the chromogranin
secretogranin family of neuroendocrine secretory proteins. It is found in secretory vesicles of neurons and endocrine cells. This gene product is a precursor to three biologically active peptides; vasostatin, pancreastatin, and parastatin. These peptides act as autocrine or paracrine negative modulators of the neuroendocrine system. Other peptides, including chromostatin, beta-granin, WE-14 and GE-25, are also derived from the full-length protein. However, biological activities for these molecules have not been shown.
secretogranin family of neuroendocrine secretory proteins. It is found in secretory vesicles of neurons and endocrine cells. This gene product is a precursor to three biologically active peptides; vasostatin, pancreastatin, and parastatin. These peptides act as autocrine or paracrine negative modulators of the neuroendocrine system. Other peptides, including chromostatin, beta-granin, WE-14 and GE-25, are also derived from the full-length protein. However, biological activities for these molecules have not been shown.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
49,328 Da
NCBI Official Full Name
chromogranin-A
NCBI Official Symbol
CHGA
NCBI Protein Information
chromogranin-A
UniProt Protein Name
Chromogranin-A
UniProt Gene Name
CHGA
UniProt Synonym Gene Names
CgA
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The CHGA chga (Catalog #AAA113625) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 17-446, Full length protein. The amino acid sequence is listed below: LPVNSPMNKG DTEVMKCIVE VISDTLSKPS PMPVSQECFE TLRGDERILS ILRHQNLLKE LQDLALQGAK ERSHQQKKQS SYEDELSEVL EKQNDQAELK EGTEEASSKE AAEKRGDSKE VEKNDEDADG AKPQASLEPP XXXEAEDQTP GEEEAASTHP LASLPSKKRP GAQAEEDHEG PSQGPVDREK GPSAEQGPQA EREEEEEAEA GEKAVPEEEG PRSEAFDSHP SLGYKEMQRG WPQAPAMDGA GKTGAEEAQP PEGKGAREHS RQEEEEETAG APQGLFRGGK RGEPAQEEEE RLSEEWENAK RWSKMDRLAK ELTAEKRLQG EEEEEEEEED PDRSMKLSFR APAYGFRGPG LQLRRGWRPS SREDSVEAGL PLQVRXYLEE KKEEEGSANR RPEDQELESL SAIEAELEKV APQLQSLRRG. It is sometimes possible for the material contained within the vial of "Chromogranin-A (CHGA), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.