Charged multivesicular body protein 2b (CHMP2B) Recombinant Protein | CHMP2B recombinant protein
Recombinant Human Charged multivesicular body protein 2b (CHMP2B)
Gene Names
CHMP2B; DMT1; ALS17; VPS2B; VPS2-2; CHMP2.5
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Charged multivesicular body protein 2b (CHMP2B); N/A; Recombinant Human Charged multivesicular body protein 2b (CHMP2B); Charged multivesicular body protein 2b; CHMP2.5; Chromatin-modifying protein 2b; CHMP2b; Vacuolar protein sorting-associated protein 2-2; Vps2-2; hVps2-2; CHMP2B recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-213aa; Full Length of Mature Protein
Sequence
ASLFKKKTVDDVIKEQNRELRGTQRAIIRDRAALEKQEKQLELEIKKMAKIGNKEACKVLAKQLVHLRKQKTRTFAVSSKVTSMSTQTKVMNSQMKMAGAMSTTAKTMQAVNKKMDPQKTLQTMQNFQKENMKMEMTEEMINDTLDDIFDGSDDEEESQDIVNQVLDEIGIEISGKMAKAPSAARSLPSASTSKATISDEEIERQLKALGVD
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for CHMP2B recombinant protein
Probable core component of the endosomal sorting required for transport complex III (ESCRT-III) which is involved in multivesicular bodies (MVBs) formation and sorting of endosomal cargo proteins into MVBs. MVBs contain intraluminal vesicles (ILVs) that are generated by invagination and scission from the limiting membrane of the endosome and mostly are delivered to lysosomes enabling degradation of membrane proteins, such as stimulated growth factor receptors, lysosomal enzymes and lipids. The MVB pathway appears to require the sequential function of ESCRT-O, -I,-II and -III complexes. ESCRT-III proteins mostly dissociate from the invaginating membrane before the ILV is released. The ESCRT machinery also functions in topologically equivalent membrane fission events, such as the terminal stages of cytokinesis and the budding of enveloped viruses (HIV-1 and other lentiviruses). ESCRT-III proteins are believed to mediate the necessary vesicle extrusion and/or membrane fission activities, possibly in conjunction with the AAA ATPase VPS4.
Product Categories/Family for CHMP2B recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
50.8 kDa
NCBI Official Full Name
charged multivesicular body protein 2b isoform 2
NCBI Official Synonym Full Names
charged multivesicular body protein 2B
NCBI Official Symbol
CHMP2B
NCBI Official Synonym Symbols
DMT1; ALS17; VPS2B; VPS2-2; CHMP2.5
NCBI Protein Information
charged multivesicular body protein 2b; VPS2 homolog B; chromatin modifying protein 2B; vacuolar protein-sorting-associated protein 2-2
UniProt Protein Name
Charged multivesicular body protein 2b
UniProt Gene Name
CHMP2B
UniProt Synonym Gene Names
CHMP2b; Vps2-2; hVps2-2
UniProt Entry Name
CHM2B_HUMAN
Similar Products
Product Notes
The CHMP2B chmp2b (Catalog #AAA117162) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-213aa; Full Length of Mature Protein. The amino acid sequence is listed below: ASLFKKKTVD DVIKEQNREL RGTQRAIIRD RAALEKQEKQ LELEIKKMAK IGNKEACKVL AKQLVHLRKQ KTRTFAVSSK VTSMSTQTKV MNSQMKMAGA MSTTAKTMQA VNKKMDPQKT LQTMQNFQKE NMKMEMTEEM INDTLDDIFD GSDDEEESQD IVNQVLDEIG IEISGKMAKA PSAARSLPSA STSKATISDE EIERQLKALG VD. It is sometimes possible for the material contained within the vial of "Charged multivesicular body protein 2b (CHMP2B), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
