Muscarinic acetylcholine receptor M3 (CHRM3) Recombinant Protein | CHRM3 recombinant protein
Recombinant Human Muscarinic acetylcholine receptor M3 (CHRM3), partial
Gene Names
CHRM3; HM3; PBS; EGBRS
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Muscarinic acetylcholine receptor M3 (CHRM3); N/A; Recombinant Human Muscarinic acetylcholine receptor M3 (CHRM3), partial; CHRM3 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
253-492aa; partial
Sequence
RIYKETEKRTKELAGLQASGTEAETENFVHPTGSSRSCSSYELQQQSMKRSNRRKYGRCHFWFTTKSWKPSSEQMDQDHSSSDSWNNNDAAASLENSASSDEEDIGSETRAIYSIVLKLPGHSTILNSTKLPSSDNLQVPEEELGMVDLERKADKLQAQKSVDDGGSFPKSFSKLPIQLESAVDTAKTSDVNSSVGKSTATLPLSFKEATLAKRFALKTRSQITKRKRMSLVKEKKAAQT
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Related Product Information for CHRM3 recombinant protein
The muscarinic acetylcholine receptor mediates various cellular responses, including inhibition of adenylate cyclase, breakdown of phosphoinositides and modulation of potassium channels through the action of G proteins. Primary transducing effect is Pi turnover.
Product Categories/Family for CHRM3 recombinant protein
References
Distinct primary structures, ligand-binding properties and tissue-specific expression of four human muscarinic acetylcholine receptors.Peralta E.G., Ashkenazi A., Winslow J.W., Smith D.H., Ramachandran J., Capon D.J.EMBO J. 6:3923-3929(1987)
Cloning and expression of the human and rat m5 muscarinic acetylcholine receptor genes.Bonner T.I., Young A.C., Brann M.R., Buckley N.J.Neuron 1:403-410(1988)
Human-specific amino acid changes found in 103 protein-coding genes.Kitano T., Liu Y.-H., Ueda S., Saitou N.Mol. Biol. Evol. 21:936-944(2004)
cDNA clones of human proteins involved in signal transduction sequenced by the Guthrie cDNA resource center (www.cdna.org)
.Puhl H.L. III, Ikeda S.R., Aronstam R.S. The DNA sequence and biological annotation of human chromosome 1.Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K., Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.Nature 441:315-321(2006)
Antisense promoter of human L1 retrotransposon drives transcription of adjacent cellular genes.Speek M.Mol. Cell. Biol. 21:1973-1985(2001)
Mutation of carboxyl-terminal threonine residues in human M3 muscarinic acetylcholine receptor modulates the extent of sequestration and desensitization.Yang J., Williams J.A., Yule D.I., Logsdon C.D.Mol. Pharmacol. 48:477-485(1995)
Muscarinic acetylcholine receptor M3 mutation causes urinary bladder disease and a prune-belly-like syndrome.Weber S., Thiele H., Mir S., Toliat M.R., Sozeri B., Reutter H., Draaken M., Ludwig M., Altmuller J., Frommolt P., Stuart H.M., Ranjzad P., Hanley N.A., Jennings R., Newman W.G., Wilcox D.T., Thiel U., Schlingmann K.P., Beetz R., Hoyer P.F., Konrad M., Schaefer F., Nurnberg P., Woolf A.S.Am. J. Hum. Genet. 89:668-674(2011)
The muscarinic M3 acetylcholine receptor exists as two differently sized complexes at the plasma membrane.Patowary S., Alvarez-Curto E., Xu T.R., Holz J.D., Oliver J.A., Milligan G., Raicu V.Biochem. J. 452:303-312(2013)
Identification and structural determination of the M(3)
muscarinic acetylcholine receptor basolateral sorting signal.Iverson H.A., Fox D. III, Nadler L.S., Klevit R.E., Nathanson N.M.J. Biol. Chem. 280:24568-24575(2005)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
28.7 kDa
NCBI Official Full Name
muscarinic acetylcholine receptor M3
NCBI Official Synonym Full Names
cholinergic receptor, muscarinic 3
NCBI Official Symbol
CHRM3
NCBI Official Synonym Symbols
HM3; PBS; EGBRS
NCBI Protein Information
muscarinic acetylcholine receptor M3
UniProt Protein Name
Muscarinic acetylcholine receptor M3
UniProt Gene Name
CHRM3
UniProt Entry Name
ACM3_HUMAN
Similar Products
Product Notes
The CHRM3 chrm3 (Catalog #AAA18451) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 253-492aa; partial. The amino acid sequence is listed below: RIYKETEKRT KELAGLQASG TEAETENFVH PTGSSRSCSS YELQQQSMKR SNRRKYGRCH FWFTTKSWKP SSEQMDQDHS SSDSWNNNDA AASLENSASS DEEDIGSETR AIYSIVLKLP GHSTILNSTK LPSSDNLQVP EEELGMVDLE RKADKLQAQK SVDDGGSFPK SFSKLPIQLE SAVDTAKTSD VNSSVGKSTA TLPLSFKEAT LAKRFALKTR SQITKRKRMS LVKEKKAAQT . It is sometimes possible for the material contained within the vial of "Muscarinic acetylcholine receptor M3 (CHRM3), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
