Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA201539_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: CHRM3Sample Tissue: Human Lung TumorAntibody Dilution: 1ug/ml)

Rabbit anti-Human CHRM3 Polyclonal Antibody | anti-CHRM3 antibody

CHRM3 Antibody - C-terminal region

Gene Names
CHRM3; HM3; PBS; EGBRS
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
CHRM3, Antibody; CHRM3 Antibody - C-terminal region; anti-CHRM3 antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GYWLCYINSTVNPVCYALCNKTFRTTFKMLLLCQCDKKKRRKQQYQQRQS
Sequence Length
590
Applicable Applications for anti-CHRM3 antibody
WB (Western Blot)
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human ACM3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(Host: RabbitTarget Name: CHRM3Sample Tissue: Human Lung TumorAntibody Dilution: 1ug/ml)

product-image-AAA201539_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: CHRM3Sample Tissue: Human Lung TumorAntibody Dilution: 1ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: ACM3Sample Type: Fetal Liver lysatesAntibody Dilution: 1.0ug/ml)

product-image-AAA201539_WB15.jpg WB (Western Blot) (Host: RabbitTarget Name: ACM3Sample Type: Fetal Liver lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-CHRM3 antibody
This is a rabbit polyclonal antibody against ACM3. It was validated on Western Blot

Target Description: The muscarinic cholinergic receptors belong to a larger family of G protein-coupled receptors. The functional diversity of these receptors is defined by the binding of acetylcholine and includes cellular responses such as adenylate cyclase inhibition, phosphoinositide degeneration, and potassium channel mediation. Muscarinic receptors influence many effects of acetylcholine in the central and peripheral nervous system. The muscarinic cholinergic receptor 3 controls smooth muscle contraction and its stimulation causes secretion of glandular tissue. Alternative promoter use and alternative splicing results in multiple transcript variants that have different tissue specificities.
Product Categories/Family for anti-CHRM3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
64kDa
NCBI Official Synonym Full Names
cholinergic receptor muscarinic 3
NCBI Official Symbol
CHRM3
NCBI Official Synonym Symbols
HM3; PBS; EGBRS
NCBI Protein Information
muscarinic acetylcholine receptor M3
UniProt Protein Name
Muscarinic acetylcholine receptor M3
UniProt Gene Name
CHRM3
UniProt Entry Name
ACM3_HUMAN

Similar Products

Product Notes

The CHRM3 chrm3 (Catalog #AAA201539) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CHRM3 Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CHRM3 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the CHRM3 chrm3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GYWLCYINST VNPVCYALCN KTFRTTFKML LLCQCDKKKR RKQQYQQRQS. It is sometimes possible for the material contained within the vial of "CHRM3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.