COVID 19 Spike S1 Coronavirus Recombinant Protein | COVID-19 recombinant protein
Spike S1 Protein (SARS-CoV-2), C-terminal his-tag, HEK293 cells
Applications
ELISA, Western Blot
Purity
>= 95% (by SDS PAGE)
Synonyms
COVID 19 Spike S1 Coronavirus; N/A; Spike S1 Protein (SARS-CoV-2), C-terminal his-tag, HEK293 cells; 2019 Novel Coronavirus; Coronavirus; CoV; COVID-19 virus; HCoV-2; Human Coronavirus 2019; SARS2; SARS-CoV-2; Severe acute respiratory syndrome coronavirus 2; Spike S1; C-terminal; his tag; COVID-19 recombinant protein
Purity/Purification
>= 95% (by SDS PAGE)
Concentration
1 ug/ul in PBS, pH7.4 (varies by lot)
Sequence Positions
19-676
Sequence
TTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNSYECDIPIGAGICASYQTHHHHHH
Applicable Applications for COVID-19 recombinant protein
ELISA, WB (Western Blot)
Endotoxin Level
<0.01 EU per 1 ug of the protein by LAL test
Viral Protein
S1 protein (amino acid 19-676) of human SARS-CoV-2 (GenBank Accession No. MN908947) with a C-terminal poly his-tag
Preparation and Storage
Store at -20 degree C; maybe stable for 6-months from the date of shipment when kept at 4 degree C. Non-hazardous. No MSDS required.
Related Product Information for COVID-19 recombinant protein
Recombinant spike S1 protein of SARS-CoV-2 purified from 293 cells
Spike S1 Protein (SARS-CoV-2/COVID-19)
The novel coronavirus (SARS-CoV-2), previously called 2019-nCoV, is a newly identified coronavirus causing the ongoing outbreak of atypical pneumonia in Wuhan China from late 2019.
The genome of SARS-CoV-2 has 89% nucleotide identity with bat SARS-like-CoVZXC21 and 82% with that of human SARS-CoV. The phylogenetic trees of their orf1a/b, Spike, Envelope, Membrane and Nucleocapsid protein also clustered closely with those of the bat, civet and human SARS coronaviruses. However, the external subdomain of Spike's receptor binding domain (RCB) of SARS-CoV-2 shares only 40% amino acid identity with other SARS-related coronaviruses.
Spike S1 Protein (SARS-CoV-2/COVID-19)
The novel coronavirus (SARS-CoV-2), previously called 2019-nCoV, is a newly identified coronavirus causing the ongoing outbreak of atypical pneumonia in Wuhan China from late 2019.
The genome of SARS-CoV-2 has 89% nucleotide identity with bat SARS-like-CoVZXC21 and 82% with that of human SARS-CoV. The phylogenetic trees of their orf1a/b, Spike, Envelope, Membrane and Nucleocapsid protein also clustered closely with those of the bat, civet and human SARS coronaviruses. However, the external subdomain of Spike's receptor binding domain (RCB) of SARS-CoV-2 shares only 40% amino acid identity with other SARS-related coronaviruses.
NCBI and Uniprot Product Information
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The COVID-19 (Catalog #AAA62215) is a Recombinant Protein and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 19-676. AAA Biotech's COVID 19 Spike S1 Coronavirus can be used in a range of immunoassay formats including, but not limited to, ELISA, WB (Western Blot). Researchers should empirically determine the suitability of the COVID-19 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: TTRTQLPPAY TNSFTRGVYY PDKVFRSSVL HSTQDLFLPF FSNVTWFHAI HVSGTNGTKR FDNPVLPFND GVYFASTEKS NIIRGWIFGT TLDSKTQSLL IVNNATNVVI KVCEFQFCND PFLGVYYKNN KSWMESEFRV YSSANNCTFE YVSQPFLMDL EGKQGNFKNL REFVFKNIDG YFKIYSKHTP INLVRDLPQG FSALEPLVDL PIGINITRFQ TLLALHRSYL TPGDSSSGWT AGAAAYYVGY LQPRFLLKYN ENGTITDAVD CALDPLSETK CTLKSFTVEK GIYQTSNFRV QPTESIVRFP NITNLCPFGE VFNATRFASV YAWNRKRISN CVADYSVLYN SASFSTFKCY GVSPTKLNDL CFTNVYADSF VRGDEVRQIA PGQTGKIADY NYKLPDDFTG CVIAWNSNNL DSKVGGNYNY LYRLFRKSNL KPFERDISTE IYQAGSTPCN GVEGFNCYFP LQSYGFQPTN GVGYQPYRVV VLSFELLHAP ATVCGPKKTN LVKNKCVNFN FNGLTGTGVL TESNKKFLPF QQFGRDIADT TDAVRDPQTL EILDITPCSF GGVSVITPGT NTSNQVAVLY QDVNCTEVPV AIHADQLTPT WRVYSTGSNV FQTRAGCLIG AEHVNSYECD IPIGAGICAS YQTHHHHHH. It is sometimes possible for the material contained within the vial of "COVID 19 Spike S1 Coronavirus, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
