Pesticidal crystal protein Cry1Ab (cry1Ab) Recombinant Protein | Cry1Ab recombinant protein
Recombinant Bacillus thuringiensis subsp. kurstaki Pesticidal crystal protein Cry1Ab (cry1Ab), partial
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Pesticidal crystal protein Cry1Ab (cry1Ab); N/A; Recombinant Bacillus thuringiensis subsp. kurstaki Pesticidal crystal protein Cry1Ab (cry1Ab), partial; 130 kDa crystal protein; Crystaline entomocidal protoxinInsecticidal delta-endotoxin CryIA(b); Cry1Ab recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1022-1155aa; partial
Sequence
HEIENNTDELKFSNCVEEEVYPNNTVTCNDYTATQEEYEGTYTSRNRGYDGAYESNSSVPADYASAYEEKAYTDGRRDNPCESNRGYGDYTPLPAGYVTKELEYFPETDKVWIEIGETEGTFIVDSVELLLMEE
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Related Product Information for Cry1Ab recombinant protein
Promotes colloidosmotic lysis by binding to the midgut epithelial cells of many lepidopteran larvae.
References
The hypervariable region in the genes coding for entomopathogenic crystal proteins of Bacillus thuringiensis
nucleotide sequence of the kurhd1 gene of subsp. kurstaki HD1.Geiser M., Schweitzer S., Grimm C.Gene 48:109-118(1986)
Structural similarity between the lepidoptera- and diptera-specific insecticidal endotoxin genes of Bacillus thuringiensis subsp. 'kurstaki' and 'israelensis'.Thorne L., Garduno F., Thompson T., Decker D., Zounes M., Wild M., Walfield A.M., Pollock T.J.J. Bacteriol. 166:801-811(1986)
Cloning and nucleotide sequencing of two insecticidal delta-endotoxin genes from Bacillus thuringiensis var. kurstaki HD-1 DNA.Kondo S., Tamura N., Kunitate A., Hattori M., Akashi A., Ohmori I.Agric. Biol. Chem. 51:455-463(1987)
Insect tolerant transgenic tomato plants.Fischhoff D.A., Bowdish K.S., Perlak F.J., Marrone P.G., McCormick S.M., Niedermeyer J.G., Dean D.A., Kusano-Kretzmer K., Mayer E.J., Rochester D.E., Rogers S.G., Fraley R.T.Biotechnology (N.Y.)
5:807-813(1987)
Sequence of a lepidopteran toxin gene of Bacillus thuringiensis subsp kurstaki NRD-12.Hefford M.A., Brousseau R., Prefontaine G., Hanna Z., Condie J.A., Lau P.C.K.J. Biotechnol. 6:307-322(1987)
Characterization of Bacillus thuringiensis subsp. kurstaki strain S93 effective against the Fall armyworm, Spodoptera frugiperda and cloning of a cry1Ab gene.Silva-Werneck J.O., De-Souza M.T., Dias J.M.C.S., Ribeiro B.M.Can. J. Microbiol. 45:464-471(1999)
NCBI and Uniprot Product Information
NCBI GI #
Molecular Weight
17.3 kDa
UniProt Protein Name
Pesticidal crystal protein Cry1Ab
UniProt Gene Name
cry1Ab
UniProt Synonym Gene Names
bt2; cry-1-2; cry1A(b); cryIA(b); cryIC1
UniProt Entry Name
CR1AB_BACTK
Similar Products
Product Notes
The Cry1Ab cry1ab (Catalog #AAA18621) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1022-1155aa; partial. The amino acid sequence is listed below: HEIENNTDEL KFSNCVEEEV YPNNTVTCND YTATQEEYEG TYTSRNRGYD GAYESNSSVP ADYASAYEEK AYTDGRRDNP CESNRGYGDY TPLPAGYVTK ELEYFPETDK VWIEIGETEG TFIVDSVELL LMEE. It is sometimes possible for the material contained within the vial of "Pesticidal crystal protein Cry1Ab (cry1Ab), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
