Loading...

Skip to main content
SDS-PAGE

Pesticidal crystal protein cry1Fb Recombinant Protein | cry1Fb recombinant protein

Recombinant Pesticidal crystal protein cry1Fb

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Pesticidal crystal protein cry1Fb; N/A; Recombinant Pesticidal crystal protein cry1Fb; 132 kDa crystal protein; Crystaline entomocidal protoxinInsecticidal delta-endotoxin CryIF(b); cry1Fb recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
984-1169aa; Partial
Sequence
VKGHVDVEEQNNHRSVLVVPEWEAEVSQEVRVCPGRGYILRVTAYKEGYGEGCVTIHEVDNNTDELKFSSNCEKEQVYPGNTVACNDYNKNHGANACSSRNGGYDESYESNSSIPADYAPVYEEEAYTDGQRGNPCEFNRGHTPLPAGYVTAELEYFPETDTVWVEIGETEGTFIVDSVELLLMEE
Sequence Length
1169
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

SDS-PAGE
Related Product Information for cry1Fb recombinant protein
Promotes colloidosmotic lysis by binding to the midgut epithelial cells of insects.
References
A novel cry1Fb gene from Bacillus thuringiensis subsp. morrisoni.Song F., Zhang J., Ding Z., Chen Z., Li G., Huang D.Masuda K., Asano S.

NCBI and Uniprot Product Information

NCBI GI #
UniProt Accession #
Molecular Weight
22.8 kDa
NCBI Official Full Name
Pesticidal crystal protein Cry1Fb
UniProt Protein Name
Pesticidal crystal protein Cry1Fb
UniProt Gene Name
cry1Fb
UniProt Synonym Gene Names
cryIF(b); cryINA67-1
UniProt Entry Name
CR1FB_BACTM

Similar Products

Product Notes

The cry1Fb cry1fb (Catalog #AAA18554) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 984-1169aa; Partial. The amino acid sequence is listed below: VKGHVDVEEQ NNHRSVLVVP EWEAEVSQEV RVCPGRGYIL RVTAYKEGYG EGCVTIHEVD NNTDELKFSS NCEKEQVYPG NTVACNDYNK NHGANACSSR NGGYDESYES NSSIPADYAP VYEEEAYTDG QRGNPCEFNR GHTPLPAGYV TAELEYFPET DTVWVEIGET EGTFIVDSVE LLLMEE. It is sometimes possible for the material contained within the vial of "Pesticidal crystal protein cry1Fb, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.