Granulocyte-macrophage colony-stimulating factor (CSF2) Recombinant Protein | CSF2 recombinant protein
Recombinant Bovine Granulocyte-macrophage colony-stimulating factor (CSF2)
Gene Names
CSF2; CSF; GMCSF; GM-CSF
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Granulocyte-macrophage colony-stimulating factor (CSF2); N/A; Recombinant Bovine Granulocyte-macrophage colony-stimulating factor (CSF2); CSF2 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
18-143. Full Length of Mature Protein
Sequence
APTRPPNTATRPWQHVDAIKEALSLLNHSSDTDAVMNDTEVVSEKFDSQEPTCLQTRLKLYKNGLQGSLTSLMGSLTMMATHYEKHCPPTPETSCGTQFISFKNFKEDLKEFLFIIPFDCWEPAQK
Species
Bovine
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for CSF2 recombinant protein
This protein is a cytokine that controls the production, differentiation, and function of granulocytes and macrophages. The active form of the protein is found extracellularly as a homodimer. This gene has been localized to a cluster of related genes at chromosome region 5q31, which is known to be associated with interstitial deletions in the 5q- syndrome and acute myelogenous leukemia. Other genes in the cluster include those encoding interleukins 4, 5, and 13.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
16,157 Da
NCBI Official Full Name
granulocyte-macrophage colony-stimulating factor
NCBI Official Synonym Full Names
colony stimulating factor 2
NCBI Official Symbol
CSF2
NCBI Official Synonym Symbols
CSF; GMCSF; GM-CSF
NCBI Protein Information
granulocyte-macrophage colony-stimulating factor
UniProt Protein Name
Granulocyte-macrophage colony-stimulating factor
UniProt Gene Name
CSF2
UniProt Synonym Gene Names
GM-CSF; CSF
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The CSF2 csf2 (Catalog #AAA113630) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 18-143. Full Length of Mature Protein. The amino acid sequence is listed below: APTRPPNTAT RPWQHVDAIK EALSLLNHSS DTDAVMNDTE VVSEKFDSQE PTCLQTRLKL YKNGLQGSLT SLMGSLTMMA THYEKHCPPT PETSCGTQFI SFKNFKEDLK EFLFIIPFDC WEPAQK. It is sometimes possible for the material contained within the vial of "Granulocyte-macrophage colony-stimulating factor (CSF2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.