Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA55979_SDS_PAGE15.jpg SDS-PAGE

Cytochrome P450 3A (CYP3A) Recombinant Protein | CYP3A recombinant protein

Recombinant Human Cytochrome P450 3A (CYP3A) Protein

Average rating 0.0
No ratings yet
Purity
> 95% as determined by SDS-PAGE
Synonyms
Cytochrome P450 3A (CYP3A); N/A; Recombinant Human Cytochrome P450 3A (CYP3A) Protein; CYP3A4; CP33; CP34; CYP3A; CYP3A3; CYPIIIA3; CYPIIIA4; HLP; NF-25; P450C3; P450PCN1; CYP3A recombinant protein
Ordering
Host
E.coli
Purity/Purification
> 95% as determined by SDS-PAGE
Form/Format
In 0.15M PBS, pH 7.4-7.5, 50% glycerol.
Concentration
0.25 mg/mL (varies by lot)
Sequence
MHHHHHHETTSSVLSFIMYELATHPDVQQKLQEEIDAVLPNKAPPTYDTVLQM EYLDMVVNETLRLFPIAMRLERVCKKDVEINGMFIPKGVVVMIPSYALHRDPKY WTEPEKFLPERFSKKNKDNIDPYIYTPFGSGPRNCIGMRFALMNMKLALIRVLQ NFSFKPCKETQIPLKLSLGGLLQPEKPVVLKVESRDGTVSG
Sequence Length
127
Source
Human
Protein Residues
with N-terminal His-tag
Preparation and Storage
Storage: Store it under sterile conditions at -20°C upon receiving. Recommend to aliquot the protein into smaller quantities for optimal storage.
**Avoid repeated freeze-thaw cycles.**
Stability: The recombinant protein is stable for up to 12 months from date of receipt at -80°C.

SDS-PAGE

product-image-AAA55979_SDS_PAGE15.jpg SDS-PAGE
Related Product Information for CYP3A recombinant protein
CYP3A4 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and its expression is induced by glucocorticoids and some pharmacological agents. This enzyme is involved in the metabolism of approximately half the drugs which are are used today, including acetaminophen, codeine, cyclosporin A, diazepam and erythromycin. The enzyme also metabolizes some steroids and carcinogens. This gene is part of a cluster of cytochrome P450 genes on chromosome 7q21.1. Previously another CYP3A gene, CYP3A3, was thought to exist; however, it is now thought that this sequence represents a transcript variant of CYP3A4.

NCBI and Uniprot Product Information

NCBI GI #
Molecular Weight
Predicted MW: 23 kDa
Observed MW: 30 kDa
NCBI Official Full Name
cytochrome P450 3A, partial
UniProt Protein Name
Cytochrome P450 3A
UniProt Gene Name
CYP3A

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The CYP3A cyp3a (Catalog #AAA55979) is a Recombinant Protein produced from E.coli and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: MHHHHHHETT SSVLSFIMYE LATHPDVQQK LQEEIDAVLP NKAPPTYDTV LQM EYLDMV VNETLRLFPI AMRLERVCKK DVEINGMFIP KGVVVMIPSY ALHRDPKY W TEPEKFLPER FSKKNKDNID PYIYTPFGSG PRNCIGMRFA LMNMKLALIR VLQ NFSFKP CKETQIPLKL SLGGLLQPEK PVVLKVESRD GTVSG. It is sometimes possible for the material contained within the vial of "Cytochrome P450 3A (CYP3A), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.