Atypical chemokine receptor 1 (ACKR1) Recombinant Protein | ACKR1 recombinant protein
Recombinant Human Atypical chemokine receptor 1 (ACKR1)(Active)
Gene Names
DARC; FY; Dfy; GPD; GpFy; CCBP1; CD234; WBCQ1
Purity
Greater than 85% as determined by SDS-PAGE.
Synonyms
Atypical chemokine receptor 1 (ACKR1); N/A; Recombinant Human Atypical chemokine receptor 1 (ACKR1)(Active); Duffy antigen/chemokine receptorFy glycoproteinShort name:GpFyGlycoprotein DPlasmodium vivax receptorCD_antigen: CD234DARC, FY, GPD; ACKR1 recombinant protein
Host
E coli (in vitro)
Purity/Purification
Greater than 85% as determined by SDS-PAGE.
Form/Format
Liquid or Lyophilized powder. If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Sequence
MGNCLHRAELSPSTENSSQLDFEDVWNSSYGVNDSFPDGDYGANLEAAAPCHSCNLLDDSALPFFILTSVLGILASSTVLFMLFRPLFRWQLCPGWPVLAQLAVGSALFSIVVPVLAPGLGSTRSSALCSLGYCVWYGSAFAQALLLGCHASLGHRLGAGQVPGLTLGLTVGIWGVAALLTLPVTLASGASGGLCTLIYSTELKALQATHTVACLAIFVLLPLGLFGAKGLKKALGMGPGPWMNILWAWFIFWWPHGVVLGLDFLVRSKLLLLSTCLAQQALDLLLNLAEALAILHCVATPLLLALFCHQATRTLLPSLPLPEGWSSHLDTLGSKS
Sequence Length
1-336aa; Full Length
Species
Homo sapiens (Human)
Tag
N-terminal 10xHis-tagged
Transmembrane Domain
7TM
Biological Activity
Measured by its binding ability in a functional ELISA. Immobilized ACKR1 at 1ug/ml can bind human CCL2, the EC50 of human CCL2 protein is 48.64-60.24ug/ml.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 degree C/-80 degree C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preparation and Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 degree C/-80 degree C. The shelf life of lyophilized form is 12 months at -20 degree C/-80 degree C.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Related Product Information for ACKR1 recombinant protein
Atypical chemokine receptor that controls chemokine levels and localization via high-affinity chemokine binding that is uncoupled from classic ligand-driven signal transduction cascades, resulting instead in chemokine sequestration, degradation, or transcytosis. Also known as interceptor (internalizing receptor) or chemokine-scavenging receptor or chemokine decoy receptor. Has a promiscuous chemokine-binding profile, interacting with inflammatory chemokines of both the CXC and the CC subfamilies but not with homeostatic chemokines. Acts as a receptor for chemokines including CCL2, CCL5, CCL7, CCL11, CCL13, CCL14, CCL17, CXCL5, CXCL6, IL8/CXCL8, CXCL11, GRO, RANTES, MCP-1, TARC and also for the malaria parasites P.vivax and P.knowlesi. May regulate chemokine bioavailability and, consequently, leukocyte recruitment through two distinct mechanisms: when expressed in endothelial cells, it sustains the abluminal to luminal transcytosis of tissue-derived chemokines and their subsequent presentation to circulating leukocytes; when expressed in erythrocytes, serves as blood reservoir of cognate chemokines but also as a chemokine sink, buffering potential surges in plasma chemokine levels.
Product Categories/Family for ACKR1 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
35,553 Da
NCBI Official Full Name
Duffy antigen/chemokine receptor isoform a
NCBI Official Synonym Full Names
Duffy blood group, chemokine receptor
NCBI Official Symbol
DARC
NCBI Official Synonym Symbols
FY; Dfy; GPD; GpFy; CCBP1; CD234; WBCQ1
NCBI Protein Information
Duffy antigen/chemokine receptor; glycoprotein D; Fy glycoprotein; Duffy blood group antigen; plasmodium vivax receptor
UniProt Protein Name
Duffy antigen/chemokine receptor
UniProt Gene Name
DARC
UniProt Synonym Gene Names
FY; GPD; GpFy
UniProt Entry Name
DUFFY_HUMAN
Similar Products
Product Notes
The ACKR1 darc (Catalog #AAA279389) is a Recombinant Protein produced from E coli (in vitro) and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: MGNCLHRAEL SPSTENSSQL DFEDVWNSSY GVNDSFPDGD YGANLEAAAP CHSCNLLDDS ALPFFILTSV LGILASSTVL FMLFRPLFRW QLCPGWPVLA QLAVGSALFS IVVPVLAPGL GSTRSSALCS LGYCVWYGSA FAQALLLGCH ASLGHRLGAG QVPGLTLGLT VGIWGVAALL TLPVTLASGA SGGLCTLIYS TELKALQATH TVACLAIFVL LPLGLFGAKG LKKALGMGPG PWMNILWAWF IFWWPHGVVL GLDFLVRSKL LLLSTCLAQQ ALDLLLNLAE ALAILHCVAT PLLLALFCHQ ATRTLLPSLP LPEGWSSHLD TLGSKS. It is sometimes possible for the material contained within the vial of "Atypical chemokine receptor 1 (ACKR1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
