Atypical chemokine receptor 1 (ACKR1) Recombinant Protein | ACKR1 recombinant protein

Recombinant Human Atypical chemokine receptor 1 (ACKR1)(Active)

Cat. Num. AAA279389

• Gene Names: DARC; FY; Dfy; GPD; GpFy; CCBP1; CD234; WBCQ1
• Purity: Greater than 85% as determined by SDS-PAGE.
• Synonyms: Atypical chemokine receptor 1 (ACKR1); N/A; Recombinant Human Atypical chemokine receptor 1 (ACKR1)(Active); Duffy antigen/chemokine receptorFy glycoproteinShort name:GpFyGlycoprotein DPlasmodium vivax receptorCD_antigen: CD234DARC, FY, GPD; ACKR1 recombinant protein

• Host: E coli (in vitro)
• Purity/Purification: Greater than 85% as determined by SDS-PAGE.
• Form/Format: Liquid or Lyophilized powder. If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Sequence: MGNCLHRAELSPSTENSSQLDFEDVWNSSYGVNDSFPDGDYGANLEAAAPCHSCNLLDDSALPFFILTSVLGILASSTVLFMLFRPLFRWQLCPGWPVLAQLAVGSALFSIVVPVLAPGLGSTRSSALCSLGYCVWYGSAFAQALLLGCHASLGHRLGAGQVPGLTLGLTVGIWGVAALLTLPVTLASGASGGLCTLIYSTELKALQATHTVACLAIFVLLPLGLFGAKGLKKALGMGPGPWMNILWAWFIFWWPHGVVLGLDFLVRSKLLLLSTCLAQQALDLLLNLAEALAILHCVATPLLLALFCHQATRTLLPSLPLPEGWSSHLDTLGSKS
• Sequence Length: 1-336aa; Full Length

• Species: Homo sapiens (Human)
• Tag: N-terminal 10xHis-tagged
• Transmembrane Domain: 7TM
• Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized ACKR1 at 1ug/ml can bind human CCL2, the EC50 of human CCL2 protein is 48.64-60.24ug/ml.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 degree C/-80 degree C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
• Preparation and Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 degree C/-80 degree C. The shelf life of lyophilized form is 12 months at -20 degree C/-80 degree C.; Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

SDS-PAGE

((Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.)

Bioactivity

Related Product Information for ACKR1 recombinant protein

Atypical chemokine receptor that controls chemokine levels and localization via high-affinity chemokine binding that is uncoupled from classic ligand-driven signal transduction cascades, resulting instead in chemokine sequestration, degradation, or transcytosis. Also known as interceptor (internalizing receptor) or chemokine-scavenging receptor or chemokine decoy receptor. Has a promiscuous chemokine-binding profile, interacting with inflammatory chemokines of both the CXC and the CC subfamilies but not with homeostatic chemokines. Acts as a receptor for chemokines including CCL2, CCL5, CCL7, CCL11, CCL13, CCL14, CCL17, CXCL5, CXCL6, IL8/CXCL8, CXCL11, GRO, RANTES, MCP-1, TARC and also for the malaria parasites P.vivax and P.knowlesi. May regulate chemokine bioavailability and, consequently, leukocyte recruitment through two distinct mechanisms: when expressed in endothelial cells, it sustains the abluminal to luminal transcytosis of tissue-derived chemokines and their subsequent presentation to circulating leukocytes; when expressed in erythrocytes, serves as blood reservoir of cognate chemokines but also as a chemokine sink, buffering potential surges in plasma chemokine levels.

Product Categories/Family for ACKR1 recombinant protein

Cardiovascular

NCBI and Uniprot Product Information

• NCBI GI #: 171846251
• NCBI GeneID: 2532
• NCBI Accession #: NP_001116423.1
• NCBI GenBank Nucleotide #: NM_001122951.2
• UniProt Accession #: Q16570; O75898; Q16300; Q8WWE3; Q9UJP0; Q9UKZ5; Q9UKZ6; Q9UQE1; A8YPG5
• Molecular Weight: 35,553 Da
• NCBI Official Full Name: Duffy antigen/chemokine receptor isoform a
• NCBI Official Synonym Full Names: Duffy blood group, chemokine receptor
• NCBI Official Symbol: DARC
• NCBI Official Synonym Symbols: FY; Dfy; GPD; GpFy; CCBP1; CD234; WBCQ1
• NCBI Protein Information: Duffy antigen/chemokine receptor; glycoprotein D; Fy glycoprotein; Duffy blood group antigen; plasmodium vivax receptor
• UniProt Protein Name: Duffy antigen/chemokine receptor
• UniProt Gene Name: DARC
• UniProt Synonym Gene Names: FY; GPD; GpFy
• UniProt Entry Name: DUFFY_HUMAN