Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us

Probable ATP-dependent RNA helicase DHX36 (DHX36) Recombinant Protein | DHX36 recombinant protein

Recombinant Human Probable ATP-dependent RNA helicase DHX36 (DHX36) , partial

Gene Names
DHX36; G4R1; RHAU; DDX36; MLEL1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Probable ATP-dependent RNA helicase DHX36 (DHX36); N/A; Recombinant Human Probable ATP-dependent RNA helicase DHX36 (DHX36) , partial; DHX36 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
89-179aa; Partial
Sequence
ERREEQIVQLLNSVQAKNDKESEAQISWFAPEDHGYGTEVSTKNTPCSENKLDIQEKKLINQEKKMFRIRNRSYIDRDSEYLLQENEPDGT
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for DHX36 recombinant protein
This gene is a member of the DEAH-box family of RNA-dependent NTPases which are named after the conserved amino acid sequence Asp-Glu-Ala-His in motif II. This protein has been shown to enhance the deadenylation and decay of mRNAs with 3 -UTR AU-rich elements (ARE-mRNA). The protein has also been shown to resolve into single strands the highly stable tetramolecular DNA configuration (G4) that can form spontaneously in guanine-rich regions of DNA. Alternative splicing results in multiple transcript variants encoding different isoforms.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
111,479 Da
NCBI Official Full Name
ATP-dependent RNA helicase DHX36 isoform 2
NCBI Official Synonym Full Names
DEAH-box helicase 36
NCBI Official Symbol
DHX36
NCBI Official Synonym Symbols
G4R1; RHAU; DDX36; MLEL1
NCBI Protein Information
ATP-dependent RNA helicase DHX36
UniProt Protein Name
ATP-dependent RNA helicase DHX36
UniProt Gene Name
DHX36
UniProt Synonym Gene Names
DDX36; KIAA1488; MLEL1; RHAU; G4R1

Similar Products

Product Notes

The DHX36 dhx36 (Catalog #AAA117300) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 89-179aa; Partial. The amino acid sequence is listed below: ERREEQIVQL LNSVQAKNDK ESEAQISWFA PEDHGYGTEV STKNTPCSEN KLDIQEKKLI NQEKKMFRIR NRSYIDRDSE YLLQENEPDG T. It is sometimes possible for the material contained within the vial of "Probable ATP-dependent RNA helicase DHX36 (DHX36), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.