Docking protein 1 (Dok1) Recombinant Protein | Dok1 recombinant protein
Recombinant Mouse Docking protein 1 (Dok1)
Gene Names
Dok1; p62DOK; AW557123
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Docking protein 1 (Dok1); N/A; Recombinant Mouse Docking protein 1 (Dok1); Dok1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-482, Full length protein
Sequence
MDGAVMEGPLFLQSQRFGTKRWRKTWAVLYPASPHGVARLEFFDHKGSSSRGGRGGSRRLDCKMIRLAECVSVVPVTVESPPEPGAVAFRLDTAQRSHLLAADAVSSTAWVQTLCRTAFPKGGWALAQTENQPKFSALEMLENSLYSPTWEGSQFWVTSQKTEASERCGLQGSYILRVEAEKLTLLTLGAQSQILEPLLFWPYTLLRRYGRDKVMFSFEAGRRCPSGPGTFTFQTSQGNDIFQAVEAAIQQQKAQGKVGQAQDILRTDSHDGETEGKTVPPPVPQDPLGSPPALYAEPLDSLRIPPGPSQDSVYSDPLGSTPAGAGEGVHSKKPLYWDLYGHVQQQLLKTKLTDSKEDPIYDEPEGLAPAPPRGLYDLPQEPRDAWWCQARLKEEGYELPYNPATDDYAVPPPRSPKPAPAPKPQGLILPESGTTRGSGSKGFSSDTALYSQVQKSGTSGAWDCGLSKVGNDRAGVKSEGST
Sequence Length
482
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Dok1 recombinant protein
Docking protein 1 is constitutively tyrosine phosphorylated in hematopoietic progenitors isolated from chronic myelogenous leukemia (CML) patients in the chronic phase. It may be a critical substrate for p210(bcr
abl), a chimeric protein whose presence is associated with CML. Docking protein 1 contains a putative pleckstrin homology domain at the amino terminus and ten PXXP SH3 recognition motifs. Docking protein 2 binds p120 (RasGAP) from CML cells. It has been postulated to play a role in mitogenic signaling.
abl), a chimeric protein whose presence is associated with CML. Docking protein 1 contains a putative pleckstrin homology domain at the amino terminus and ten PXXP SH3 recognition motifs. Docking protein 2 binds p120 (RasGAP) from CML cells. It has been postulated to play a role in mitogenic signaling.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
52,452 Da
NCBI Official Full Name
docking protein 1 isoform 2
NCBI Official Synonym Full Names
docking protein 1
NCBI Official Symbol
Dok1
NCBI Official Synonym Symbols
p62DOK; AW557123
NCBI Protein Information
docking protein 1
UniProt Protein Name
Docking protein 1
UniProt Gene Name
Dok1
UniProt Synonym Gene Names
Dok
Similar Products
Product Notes
The Dok1 dok1 (Catalog #AAA113195) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-482, Full length protein. The amino acid sequence is listed below: MDGAVMEGPL FLQSQRFGTK RWRKTWAVLY PASPHGVARL EFFDHKGSSS RGGRGGSRRL DCKMIRLAEC VSVVPVTVES PPEPGAVAFR LDTAQRSHLL AADAVSSTAW VQTLCRTAFP KGGWALAQTE NQPKFSALEM LENSLYSPTW EGSQFWVTSQ KTEASERCGL QGSYILRVEA EKLTLLTLGA QSQILEPLLF WPYTLLRRYG RDKVMFSFEA GRRCPSGPGT FTFQTSQGND IFQAVEAAIQ QQKAQGKVGQ AQDILRTDSH DGETEGKTVP PPVPQDPLGS PPALYAEPLD SLRIPPGPSQ DSVYSDPLGS TPAGAGEGVH SKKPLYWDLY GHVQQQLLKT KLTDSKEDPI YDEPEGLAPA PPRGLYDLPQ EPRDAWWCQA RLKEEGYELP YNPATDDYAV PPPRSPKPAP APKPQGLILP ESGTTRGSGS KGFSSDTALY SQVQKSGTSG AWDCGLSKVG NDRAGVKSEG ST. It is sometimes possible for the material contained within the vial of "Docking protein 1 (Dok1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.