C-C motif chemokine 3 protein (Ccl3) Active Protein | Ccl3 active protein
Recombinant Rat C-C motif chemokine 3 protein (Ccl3) (Active)
Gene Names
Ccl3; Scya3; MIP-1a
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
C-C motif chemokine 3 protein (Ccl3); N/A; Recombinant Rat C-C motif chemokine 3 protein (Ccl3) (Active); Macrophage inflammatory protein 1-alpha; Small-inducible cytokine A3; Ccl3 active protein
Host
E Coli
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized
Sequence Positions
24-92aa; Full Length of Mature Protein
Sequence
APYGADTPTACCFSYGRQIPRKFIADYFETSSLCSQPGVIFLTKRNRQICADPKETWVQEYITELELNA
Species
Rattus norvegicus (Rat)
Biological Activity
Fully biologically active when compared to standard. The biological activity determined by a chemoattract bioassay using human blood monocytes is in a concentration range of 10-100 ng/ml.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Protein Note
Protein will be provided with aseptic processing and endotoxin removal.
Preparation and Storage
Generally, the shelf life of liquid form is 6 months at -20/-80 degree C. The shelf life of lyophilized form is 12 months at -20/-80 degree C.
Related Product Information for Ccl3 active protein
Monokine with inflammatory and chemokinetic properties. Has chemotactic activity for monocytes, neutrophils, eosinophils, basophils, and lymphocytes. Required for lung TNF-alpha production, neutrophil recruitment and subsequent lung injury and may function as an autocrine mediator for the macrophage production of TNF-alpha which in turn up-regulates vascular adhesion molecules required for neutrophil influx. This protein binds heparin.
Product Categories/Family for Ccl3 active protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
7.9 kDa
NCBI Official Full Name
C-C motif chemokine 3
NCBI Official Synonym Full Names
C-C motif chemokine ligand 3
NCBI Official Symbol
Ccl3
NCBI Official Synonym Symbols
Scya3; MIP-1a
NCBI Protein Information
C-C motif chemokine 3
UniProt Protein Name
C-C motif chemokine 3
UniProt Gene Name
Ccl3
UniProt Synonym Gene Names
Mip1a; Scya3; MIP-1-alpha
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The Ccl3 ccl3 (Catalog #AAA114236) is an Active Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 24-92aa; Full Length of Mature Protein. The amino acid sequence is listed below: APYGADTPTA CCFSYGRQIP RKFIADYFET SSLCSQPGVI FLTKRNRQIC ADPKETWVQE YITELELNA. It is sometimes possible for the material contained within the vial of "C-C motif chemokine 3 protein (Ccl3), Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
