APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPS CVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHN KCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQ LELNERTCRCDKPRR
Application Data
(Binding of Biotinylated VEGF165 to anti-human VEGF-A #3C5 in a functional ELISA. Anti-human VEGF-A antibody was coated with 0,5ug/ml (100ul/well) and Biotinylated VEGF165 was added starting with 3.125 ng/ml to 200 ng/ml.)
Application Data
(Binding of Biotinylated VEGF165 to human soluble VEGFR-1/Flt-1 in a BioLISA. Recombinant human soluble VEGFR-1/Flt-1 was coated with 1ug/ml (100ul/well) over night at 4 degree C and Biotinylated VEGF165 was added.)
NCBI and Uniprot Product Information
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The VEGF165 vegfa (Catalog #AAA79318) is an Active Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The Human VEGF165-Biotin reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Result by N-terminal sequencing -APMAEGGAPMAEGGG QNHHEVVKFM DVYQRSYCHP IETLVDIFQE YPDEIEYIFK PS CVPLMRCGGC CNDEGLECVP TEESNITMQI MRIKPHQGQH IGEMSFLQHN KCECRPKKDR ARQENPCGPC SERRKHLFVQ DPQTCKCSCK NTDSRCKARQ LELNERTCRC DKPRR. It is sometimes possible for the material contained within the vial of "VEGF165, Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
