VEGF165 active protein

Human VEGF165-Biotin

Cat. Num. AAA79318

• Gene Names: VEGFA; VPF; VEGF; MVCD1
• Reactivity: Human
• Purity: > 95% by SDS-PAGE & Coomassie stain
• Synonyms: VEGF165; N/A; Human VEGF165-Biotin; Vascular endothelial growth factor A; VEGFA; VPF; VEGF; MVCD1; VEGF165 active protein

• Host: E Coli
• Reactivity: Human
• Purity/Purification: > 95% by SDS-PAGE & Coomassie stain
• Form/Format: Lyophilized
• Sequence: Result by N-terminal sequencing-APMAEGG; APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPS CVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHN KCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQ LELNERTCRCDKPRR
• Sequence Length: 412

• Reconstitution: The lyophilized VEGF165-Biotin should be reconstituted in 50 mM acetic acid to a concentration not lower than 50 ug/ml. For long term storage we recommend to add at least 0.1% human or bovine serum albumin.
• Biological Activity: Tested in a functional ELISA.
• Label: Biotin
• Preparation and Storage: Lyophilized samples are stable for greater than six months at -20 degree C to -70 degree C. Reconstituted VEGF165-Biotin should be stored in working aliquots at -20 degree C.

Application Data

(Binding of Biotinylated VEGF165 to anti-human VEGF-A #3C5 in a functional ELISA. Anti-human VEGF-A antibody was coated with 0,5ug/ml (100ul/well) and Biotinylated VEGF165 was added starting with 3.125 ng/ml to 200 ng/ml.)

Application Data

(Binding of Biotinylated VEGF165 to human soluble VEGFR-1/Flt-1 in a BioLISA. Recombinant human soluble VEGFR-1/Flt-1 was coated with 1ug/ml (100ul/well) over night at 4 degree C and Biotinylated VEGF165 was added.)

Related Product Information for VEGF165 active protein

Human Vascular Endothelial Growth Factor VEGF165, a 23 kDa protein consisting of 165 amino acid residues, is produced as a homodimer. VEGF is a polypeptide growth factor and a member of the platelet-derived growth factor family. It is a specific mitogen for vascular endothelial cells and a strong angiogenic factor in vivo. Two high-affinity tyrosine kinase receptors for VEGF165 have been identified, VEGFR-1 (FLT-1), and VEGFR-2 (KDR). Consistent with the endothelial cell-specific action of VEGF165, expression of both receptor genes has been found predominantly but not exclusively on endothelial cells. Expression of VEGFR-1 was also found on human monocytes, neutrophils (PMNs), bovine brain pericytes and villous and extra villous trophoblast. In addition to its action as a mitogen it is a potent vascular permeability factor (VPF) in vivo. VEGF165 is also a chemo attractant molecule for monocytes and endothelial cells. 5 different proteins are generated by differential splicing: VEGF121, VEGF145, VEGF165, VEGF189 and VEGF206. The most abundant form is VEGF165. Whereas VEGF121 and VEGF165 are secreted proteins, VEGF145, VEGF189 and VEGF206 are strongly cell-associated. The isoforms VEGF145, VEGF165 and VEGF189 bind to heparin with high affinity. VEGF165 is apparently a homo-dimer, but preparations of VEGF165 show some heterogeneity on SDS gels, depending on the secretion of different glycosylation patterns. All dimeric forms have similar biological activities but their bioavailability is very different. There is good evidence that different cells and tissues express different VEGF isoforms. The other members of this increasing growth factor family are VEGF-B, -C, -D and -E. Another member is the Placenta growth factor PlGF.

Product Categories/Family for VEGF165 active protein

Recombinant Protein; Cytokines & Growth Factors; VEGF165-Biotin

References

Kremer at al., Cancer Res 57:3852, (1997); Flamme et al., Dev Biol 162:699, (1995); Fiebig et al., Eur J Biochem 211:19, (1993); Breier et al., Dev 114:521, (1992)

NCBI and Uniprot Product Information

• NCBI GI #: 76781480
• NCBI GeneID: 7422
• NCBI Accession #: NP_001020537.2
• NCBI GenBank Nucleotide #: NM_001025366.2
• UniProt Accession #: P15692; O60720; O75875; Q074Z4; Q16889; B5BU86; H0Y2S8; H0Y407; H0Y414; H0Y462; H0Y8N2; H3BLW7
• Molecular Weight: 34,406 Da
• NCBI Official Full Name: vascular endothelial growth factor A isoform a
• NCBI Official Synonym Full Names: vascular endothelial growth factor A
• NCBI Official Symbol: VEGFA
• NCBI Official Synonym Symbols: VPF; VEGF; MVCD1
• NCBI Protein Information: vascular endothelial growth factor A
• UniProt Protein Name: Vascular endothelial growth factor A
• UniProt Gene Name: VEGFA
• UniProt Synonym Gene Names: VEGF; VEGF-A; VPF
• UniProt Entry Name: VEGFA_HUMAN