Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA55773_SDS_PAGE15.jpg SDS-PAGE

Epididymis protein 4 Recombinant Protein | HE4 recombinant protein

Recombinant Human Epididymis protein 4 (HE4)

Purity
> 90 % as determined by SDS-PAGE.
Synonyms
Epididymis protein 4; N/A; Recombinant Human Epididymis protein 4 (HE4); WFDC2; WAP5; EDDM4; Epididymal Protein 4; Epididymal Secretory Protein E4; Putative Protease Inhibitor WAP5; Major epididymis-specific protein E4.; HE4 recombinant protein
Ordering
Host
E. coli AA 21-124 (Q14508).
Purity/Purification
> 90 % as determined by SDS-PAGE.
Form/Format
58 mM Na2HPO4, 17 mM NaH2PO4, 68 mM NaCl, 300 mM Imidazole, pH 8.0,with 15% glycerol.
Concentration
1.5 mg/mL (varies by lot)
Source
Human
Protein residues
with N-terminal 6×His-tag.
Protein sequences
GFTLVSGTGAEKTGVCPELQADQNCTQECVSDSECADNLKCCSAGCATFCSL PNDKEGSCPQVNINFPQLGLCRDQCQVDSQCPGQMKCCRNGCGKVSCVTPNF
[Predicted molecular mass]
Predicted MW: 17 kDa
Observed MW: 17 kDa
Endotoxin level
Please contact us for more information.
USAGE
HE4 Protein-Centrifuge the standard vial at 6000-1000rpm for 30s.
Preparation and Storage
Store it under sterile conditions at -20°C upon receiving. Recommend to aliquot the protein into smaller quantities for optimal storage.

Avoid repeated freeze-thaw cycles.

The recombinant protein is stable for up to 6 months from date of receipt at -80°C .

SDS-PAGE

product-image-AAA55773_SDS_PAGE15.jpg SDS-PAGE
Related Product Information for HE4 recombinant protein
WAP four-disulfide core domain protein 2 - also known as Human EpididymisProtein 4 (HE4), is a protein that is a member of the WFDC domain family. The WFDC domain, or WAP Signature motif, contains eight cysteines forming four disulfide bonds at the core of the protein, and functions as a protease inhibitor in many family members. This gene is expressed in pulmonary epithelial cells, and was also found to be expressed in some ovarian cancers. The encoded protein is a small secretory protein, which may be involved in sperm maturation. Expressed in a number of normal tissues, including male reproductive system, regions of the respiratory tract and nasopharynx. Highly expressed in a number of tumors cells lines, such ovarian, colon, breast, lung and renal cells lines. Initially described as being exclusively transcribed in the epididymis.

Similar Products

Product Notes

The HE4 (Catalog #AAA55773) is a Recombinant Protein produced from E. coli AA 21-124 (Q14508). and is intended for research purposes only. The product is available for immediate purchase. It is sometimes possible for the material contained within the vial of "Epididymis protein 4, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.