Coagulation factor XII (F12) Recombinant Protein | F12 recombinant protein
Recombinant Pig Coagulation factor XII (F12)
Gene Names
F12; FXII
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Coagulation factor XII (F12); N/A; Recombinant Pig Coagulation factor XII (F12); Coagulation factor XII; EC=3.4.21.38; Hageman factor; HAFCleaved into the following 2 chains:; 1. Coagulation factor XIIa heavy chain; 2. Coagulation factor XIIa light chain; F12 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
20-371aa; Partial
Sequence
IPPWKDPRKHKVMASEHTVVLTVTGEPCHFPFQYYRQLYYKCIQRGQRGPRPWCATTPNFEKDQRWAYCLEPMKVKDHCNKGNPCQKGGTCVNMPNGPHCICPDHFTGKHCQKEKCFEPQFLQFFQENEIWHRFEPAGVSKCQCKGPKAQCKPVASQVCSTNPCLNGGSCLQTEGHRLCRCPTGYAGRLCDVDLKERCYSDRGLSYRGMAQTTLSGAPCQPWASEATYWNMTAEQALNWGLGDHAFCRNPDNDTRPWCFVWRGDQLSWQYCRLARCQAPIGEAPPILTPTQSPSEHQDSPLLSREPQPTTQTPSQNLTSAWCAPPEQRGPLPSAGLVGCGQRLRKRLSSLNR
Sequence Length
371
Species
Sus scrofa (Pig)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for F12 recombinant protein
Factor XII is a serum glycoprotein that participates in the initiation of blood coagulation, fibrinolysis, and the generation of bradykinin and angiotensin. Prekallikrein is cleaved by factor XII to form kallikrein, which then cleaves factor XII first to alpha-factor XIIa and then trypsin cleaves it to beta-factor XIIa. Alpha-factor XIIa activates factor XI to factor XIa (By similarity).
Product Categories/Family for F12 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
41.8 kDa
NCBI Official Full Name
coagulation factor XII
NCBI Official Symbol
F12
NCBI Official Synonym Symbols
FXII
NCBI Protein Information
coagulation factor XII; HAF; hageman factor
UniProt Protein Name
Coagulation factor XII
UniProt Gene Name
F12
UniProt Synonym Gene Names
HAF
UniProt Entry Name
FA12_PIG
Similar Products
Product Notes
The F12 f12 (Catalog #AAA115598) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 20-371aa; Partial. The amino acid sequence is listed below: IPPWKDPRKH KVMASEHTVV LTVTGEPCHF PFQYYRQLYY KCIQRGQRGP RPWCATTPNF EKDQRWAYCL EPMKVKDHCN KGNPCQKGGT CVNMPNGPHC ICPDHFTGKH CQKEKCFEPQ FLQFFQENEI WHRFEPAGVS KCQCKGPKAQ CKPVASQVCS TNPCLNGGSC LQTEGHRLCR CPTGYAGRLC DVDLKERCYS DRGLSYRGMA QTTLSGAPCQ PWASEATYWN MTAEQALNWG LGDHAFCRNP DNDTRPWCFV WRGDQLSWQY CRLARCQAPI GEAPPILTPT QSPSEHQDSP LLSREPQPTT QTPSQNLTSA WCAPPEQRGP LPSAGLVGCG QRLRKRLSSL NR. It is sometimes possible for the material contained within the vial of "Coagulation factor XII (F12), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
