Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA283383_AD13.jpg Application Data (Recombinant Human Fas ligand/APTL/CD95 ligand/CD178 induce apoptosis of Jurkat human acute T cell leukemia cells. The ED<sub>50</sub> for this effect is 2.075-8.3 ng/mL in the presence of 10 ug/mL of a cross-linking antibody Rabbit Anti-poly Histidine Monoclonal Antibody, corresponding to a specific activity of 1.20×10<sup>5</sup>~4.82×10<sup>5</sup> units/mg.)

TNFSF6/FAS ligand/CD178 Recombinant Protein | APTL recombinant protein

Recombinant Human TNFSF6/FAS ligand/CD178 Protein

Purity
>95% by Tris-Bis PAGE
Synonyms
TNFSF6/FAS ligand/CD178; N/A; Recombinant Human TNFSF6/FAS ligand/CD178 Protein; FASLG, ALPS1B, APT1LG1, APTL, CD178, CD95-L, CD95L, FASL, TNFSF6, TNLG1A, Fas ligand, FasL, FasLG; APTL recombinant protein
Ordering
Host
HEK293 cells
Purity/Purification
>95% by Tris-Bis PAGE
Form/Format
Lyophilized from a 0.22 um filtered solution of PBS, pH7.4.
Sequence
PSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL
Species
Human
Tag
N-His
Endotoxin
<1 EU/ug of the protein by LAL method.
Bio-Activity
Measured by its ability to induce apoptosis of Jurkat human acute T cell leukemia cells. The ED50 for this effect is 2.075-8.3ng/mL in the presence of 10ug/mL of a cross-linking antibody Rabbit Anti-poly Histidine Monoclonal Antibody , corresponding to a specific activity of 1.20×105~4.82×105 units/mg.
Preparation and Storage
Store at -20 degree C. Store the lyophilized protein at -20 degree C to -80 degree C up to 1 year from the date of receipt.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.

Application Data

(Recombinant Human Fas ligand/APTL/CD95 ligand/CD178 induce apoptosis of Jurkat human acute T cell leukemia cells. The ED<sub>50</sub> for this effect is 2.075-8.3 ng/mL in the presence of 10 ug/mL of a cross-linking antibody Rabbit Anti-poly Histidine Monoclonal Antibody, corresponding to a specific activity of 1.20×10<sup>5</sup>~4.82×10<sup>5</sup> units/mg.)

product-image-AAA283383_AD13.jpg Application Data (Recombinant Human Fas ligand/APTL/CD95 ligand/CD178 induce apoptosis of Jurkat human acute T cell leukemia cells. The ED<sub>50</sub> for this effect is 2.075-8.3 ng/mL in the presence of 10 ug/mL of a cross-linking antibody Rabbit Anti-poly Histidine Monoclonal Antibody, corresponding to a specific activity of 1.20×10<sup>5</sup>~4.82×10<sup>5</sup> units/mg.)

SDS-PAGE

(Recombinant Human Fas ligand/APTL/CD95 ligand/CD178 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 25-35 kDa.)

product-image-AAA283383_SDS_PAGE15.jpg SDS-PAGE (Recombinant Human Fas ligand/APTL/CD95 ligand/CD178 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 25-35 kDa.)
Product Categories/Family for APTL recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
356
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
UniProt Protein Name
Tumor necrosis factor ligand superfamily member 6
UniProt Gene Name
FASLG
UniProt Synonym Gene Names
APT1LG1; CD95L; FASL; TNFSF6; APTL; CD95-L; Fas ligand; FasL; sFasL; APL; FasL ICD; SPA
UniProt Entry Name
TNFL6_HUMAN

Similar Products

Product Notes

The APTL faslg (Catalog #AAA283383) is a Recombinant Protein produced from HEK293 cells and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: PSPPPEKKEL RKVAHLTGKS NSRSMPLEWE DTYGIVLLSG VKYKKGGLVI NETGLYFVYS KVYFRGQSCN NLPLSHKVYM RNSKYPQDLV MMEGKMMSYC TTGQMWARSS YLGAVFNLTS ADHLYVNVSE LSLVNFEESQ TFFGLYKL. It is sometimes possible for the material contained within the vial of "TNFSF6/FAS ligand/CD178, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.