Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA113989_SDS_PAGE15.jpg SDS-PAGE

Fibroblast growth factor receptor 3 (FGFR3) Recombinant Protein | FGFR3 recombinant protein

Recombinant Human Fibroblast growth factor receptor 3 (FGFR3), partial

Average rating 0.0
No ratings yet
Gene Names
FGFR3; ACH; CEK2; JTK4; CD333; HSFGFR3EX
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Fibroblast growth factor receptor 3 (FGFR3); N/A; Recombinant Human Fibroblast growth factor receptor 3 (FGFR3), partial; Recombinant Human Fibroblast growth factor receptor 3 (FGFR3) (His tagged); Fibroblast growth factor receptor 3; FGFR-3; EC=2.7.10.1; CD_antigen= CD333; FGFR3 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
397-806aa; partial
Sequence
RLRSPPKKGLGSPTVHKISRFPLKRQVSLESNASMSSNTPLVRIARLSSGEGPTLANVSELELPADPKWELSRARLTLGKPLGEGCFGQVVMAEAIGIDKDRAAKPVTVAVKMLKDDATDKDLSDLVSEMEMMKMIGKHKNIINLLGACTQGGPLYVLVEYAAKGNLREFLRARRPPGLDYSFDTCKPPEEQLTFKDLVSCAYQVARGMEYLASQKCIHRDLAARNVLVTEDNVMKIADFGLARDVHNLDYYKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLLWEIFTLGGSPYPGIPVEELFKLLKEGHRMDKPANCTHDLYMIMRECWHAAPSQRPTFKQLVEDLDRVLTVTSTDEYLDLSAPFEQYSPGGQDTPSSSSSGDDSVFAHDLLPPAPPSSGGSRT
Species
Homo sapiens (Human)
Protein Information
Extracellular domain
Preparation and Storage
Store at -20 degree C. For extended storage, conserve at -20 degree C or -80 degree C. Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

SDS-PAGE

product-image-AAA113989_SDS_PAGE15.jpg SDS-PAGE
Related Product Information for FGFR3 recombinant protein
Tyrosine-protein kinase that acts as cell-surface receptor for fibroblast growth factors and plays an essential role in the regulation of cell proliferation, differentiation and apoptosis. Plays an essential role in the regulation of chondrocyte differentiation, proliferation and apoptosis, and is required for normal skeleton development. Regulates both osteogenesis and postnatal bone mineralization by osteoblasts. Promotes apoptosis in chondrocytes, but can also promote cancer cell proliferation. Required for normal development of the inner ear. Phosphorylates PLCG1, CBL and FRS2. Ligand binding leads to the activation of several signaling cascades. Activation of PLCG1 leads to the production of the cellular signaling molecules diacylglycerol and inositol 1,4,5-trisphosphate. Phosphorylation of FRS2 triggers recruitment of GRB2, GAB1, PIK3R1 and SOS1, and mediates activation of RAS, MAPK1/ERK2, MAPK3/ERK1 and the MAP kinase signaling pathway, as well as of the AKT1 signaling pathway. Plays a role in the regulation of vitamin D metabolism. Mutations that lead to constitutive kinase activation or impair normal FGFR3 maturation, internalization and degradation lead to aberrant signaling. Over-expressed or constitutively activated FGFR3 promotes activation of PTPN11/SHP2, STAT1, STAT5A and STAT5B. Secreted isoform 3 retains its capacity to bind FGF1 and FGF2 and hence may interfere with FGF signaling.
Product Categories/Family for FGFR3 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
47.4 kDa
NCBI Official Full Name
fibroblast growth factor receptor 3 isoform 1
NCBI Official Synonym Full Names
fibroblast growth factor receptor 3
NCBI Official Symbol
FGFR3
NCBI Official Synonym Symbols
ACH; CEK2; JTK4; CD333; HSFGFR3EX
NCBI Protein Information
fibroblast growth factor receptor 3; FGFR-3; tyrosine kinase JTK4; hydroxyaryl-protein kinase; fibroblast growth factor receptor 3 variant 4
UniProt Protein Name
Fibroblast growth factor receptor 3
UniProt Gene Name
FGFR3
UniProt Synonym Gene Names
JTK4; FGFR-3
UniProt Entry Name
FGFR3_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The FGFR3 fgfr3 (Catalog #AAA113989) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 397-806aa; partial. The amino acid sequence is listed below: RLRSPPKKGL GSPTVHKISR FPLKRQVSLE SNASMSSNTP LVRIARLSSG EGPTLANVSE LELPADPKWE LSRARLTLGK PLGEGCFGQV VMAEAIGIDK DRAAKPVTVA VKMLKDDATD KDLSDLVSEM EMMKMIGKHK NIINLLGACT QGGPLYVLVE YAAKGNLREF LRARRPPGLD YSFDTCKPPE EQLTFKDLVS CAYQVARGME YLASQKCIHR DLAARNVLVT EDNVMKIADF GLARDVHNLD YYKKTTNGRL PVKWMAPEAL FDRVYTHQSD VWSFGVLLWE IFTLGGSPYP GIPVEELFKL LKEGHRMDKP ANCTHDLYMI MRECWHAAPS QRPTFKQLVE DLDRVLTVTS TDEYLDLSAP FEQYSPGGQD TPSSSSSGDD SVFAHDLLPP APPSSGGSRT. It is sometimes possible for the material contained within the vial of "Fibroblast growth factor receptor 3 (FGFR3), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.