Bis(5'-adenosyl)-triphosphatase Recombinant Protein | Fhit recombinant protein
Recombinant Mouse Bis(5'-adenosyl)-triphosphatase
Gene Names
Fhit; Fra14A2; AW045638
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Bis(5'-adenosyl)-triphosphatase; N/A; Recombinant Mouse Bis(5'-adenosyl)-triphosphatase; AP3A hydrolase; AP3; Aase; Diadenosine 5',5'''-P1,P3-triphosphate hydrolase; Dinucleosidetriphosphatase; Fragile histidine triad protein; Fhit recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-150aa; Full Length
Sequence
SFRFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLVCPLRPVERFRDLHPDEVADLFQVTQRVGTVVEKHFQGTSITFSMQDGPEAGQTVKHVHVHVLPRKAGDFPRNDNIYDELQKHDREEEDSPAFWRSEKEMAAEAEALRVYFQA
Sequence Length
150
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Related Product Information for Fhit recombinant protein
Cleaves P(1)-P(3)-bis(5'-adenosyl) triphosphate (Ap3A) to yield AMP and ADP. Can also hydrolyze P(1)-P(4)-bis(5'-adenosyl) tetraphosphate (Ap4A), but has extrely low activity with ATP. Modulates transcriptional activation by CTNNB1 and thereby contributes to regulate the expression of genes essential for cell proliferation and survival, such as CCND1 and BIRC5. Plays a role in the induction of apoptosis via SRC and AKT1 signaling pathways. Inhibits MDM2-mediated proteasomal degradation of p53/TP53 and thereby plays a role in p53/TP53-mediated apoptosis. Induction of apoptosis depends on the ability of FHIT to bind P(1)-P(3)-bis(5'-adenosyl) triphosphate or related compounds, but does not require its catalytic activity. Functions as tumor suppressor.
References
The murine Fhit locus isolation, characterization, and expression in normal and tumor cells.Pekarsky Y., Druck T., Cotticelli M.G., Ohta M., Shou J., Mendrola J., Montgomery J.C., Buchberg A.M., Siracusa L.D., Manenti G., Fong L.Y., Dragani T.A., Croce C.M., Huebner K.Cancer Res. 58:3401-3408(1998) Nitrilase and Fhit homologs are encoded as fusion proteins in Drosophila melanogaster and Caenorhabditis elegans.Pekarsky Y., Campiglio M., Siprashvili Z., Druck T., Sedkov Y., Tillib S., Draganescu A., Wermuth P., Rothman J.H., Huebner K., Buchberg A.M., Mazo A., Brenner C., Croce C.M.Proc. Natl. Acad. Sci. U.S.A. 95:8744-8749(1998) Muir-Torre-like syndrome in Fhit-deficient mice.Fong L.Y., Fidanza V., Zanesi N., Lock L.F., Siracusa L.D., Mancini R., Siprashvili Z., Ottey M., Martin S.E., Druck T., McCue P.A., Croce C.M., Huebner K.Proc. Natl. Acad. Sci. U.S.A. 97:4742-4747(2000) The tumor spectrum in FHIT-deficient mice.Zanesi N., Fidanza V., Fong L.Y., Mancini R., Druck T., Valtieri M., Rudiger T., McCue P.A., Croce C.M., Huebner K.Proc. Natl. Acad. Sci. U.S.A. 98:10250-10255(2001)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
19.1 kDa
NCBI Official Full Name
bis(5'-adenosyl)-triphosphatase isoform 2
NCBI Official Synonym Full Names
fragile histidine triad gene
NCBI Official Symbol
Fhit
NCBI Official Synonym Symbols
Fra14A2; AW045638
NCBI Protein Information
bis(5'-adenosyl)-triphosphatase
UniProt Protein Name
Bis(5'-adenosyl)-triphosphatase
UniProt Gene Name
Fhit
UniProt Synonym Gene Names
AP3Aase
UniProt Entry Name
FHIT_MOUSE
Similar Products
Product Notes
The Fhit fhit (Catalog #AAA115634) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-150aa; Full Length. The amino acid sequence is listed below: SFRFGQHLIK PSVVFLKTEL SFALVNRKPV VPGHVLVCPL RPVERFRDLH PDEVADLFQV TQRVGTVVEK HFQGTSITFS MQDGPEAGQT VKHVHVHVLP RKAGDFPRND NIYDELQKHD REEEDSPAFW RSEKEMAAEA EALRVYFQA. It is sometimes possible for the material contained within the vial of "Bis(5'-adenosyl)-triphosphatase, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
