Ferrichrome-iron receptor (fhuA) Recombinant Protein | fhuA recombinant protein
Recombinant Escherichia coli Ferrichrome-iron receptor (fhuA), partial
Gene Names
fhuA; ECK0149; JW0146; T1; tonA
Purity
Greater than 95% as determined by SDS-PAGE.
Synonyms
Ferrichrome-iron receptor (fhuA); N/A; Recombinant Escherichia coli Ferrichrome-iron receptor (fhuA), partial; Ferric hydroxamate receptor; Ferric hydroxamate uptake; Ferrichrome-iron receptor; fhuA recombinant protein
Host
E coli
Purity/Purification
Greater than 95% as determined by SDS-PAGE.
Form/Format
Liquid or Lyophilized powder. If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Sequence
QNEPETGYYGWLPKEGTVEPLPNGKRLPTDFNEGAKNNTYSRNEKMVGYSFDHEFNDTFTVRQNLRFAENKTSQNSVYGYGVCSDPANAYSKQCAALAPADKGHYLARKYVVDDEKLQN
Sequence Length
269-387aa; partial
Species
Escherichia coli (strain K12)
Tag
C-terminal 6xHis-tagged
Transmembrane Domain
2TM
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 degree C/-80 degree C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preparation and Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 degree C/-80 degree C. The shelf life of lyophilized form is 12 months at -20 degree C/-80 degree C.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Related Product Information for fhuA recombinant protein
Involved in the uptake of iron in complex with ferrichrome, a hydroxamate-type siderophore. Binds and transports ferrichrome-iron across the outer membrane. In addition to its role in ferrichrome-iron transport, transports the antibiotic albomycin, which is a structural analog of ferrichrome, and acts as a receptor for colicin M, microcin J25 and bacteriophages T1, T5, phi80 and UC-1. The energy source, which is required for all FhuA functions except infection by phage T5, is provided by the inner membrane TonB system.
Product Categories/Family for fhuA recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
82,182 Da
NCBI Official Full Name
ferrichrome outer membrane transporter
NCBI Official Symbol
fhuA
NCBI Official Synonym Symbols
ECK0149; JW0146; T1; tonA
NCBI Protein Information
ferrichrome outer membrane transporter
UniProt Protein Name
Ferrichrome outer membrane transporter/phage receptor
UniProt Gene Name
fhuA
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The fhuA fhua (Catalog #AAA279392) is a Recombinant Protein produced from E coli and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: QNEPETGYYG WLPKEGTVEP LPNGKRLPTD FNEGAKNNTY SRNEKMVGYS FDHEFNDTFT VRQNLRFAEN KTSQNSVYGY GVCSDPANAY SKQCAALAPA DKGHYLARKY VVDDEKLQN. It is sometimes possible for the material contained within the vial of "Ferrichrome-iron receptor (fhuA), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
