Ferrichrome-iron receptor (fhuA) Recombinant Protein | fhuA recombinant protein

Recombinant Escherichia coli Ferrichrome-iron receptor (fhuA), partial

Cat. Num. AAA279392

• Gene Names: fhuA; ECK0149; JW0146; T1; tonA
• Purity: Greater than 95% as determined by SDS-PAGE.
• Synonyms: Ferrichrome-iron receptor (fhuA); N/A; Recombinant Escherichia coli Ferrichrome-iron receptor (fhuA), partial; Ferric hydroxamate receptor; Ferric hydroxamate uptake; Ferrichrome-iron receptor; fhuA recombinant protein

• Host: E coli
• Purity/Purification: Greater than 95% as determined by SDS-PAGE.
• Form/Format: Liquid or Lyophilized powder. If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Sequence: QNEPETGYYGWLPKEGTVEPLPNGKRLPTDFNEGAKNNTYSRNEKMVGYSFDHEFNDTFTVRQNLRFAENKTSQNSVYGYGVCSDPANAYSKQCAALAPADKGHYLARKYVVDDEKLQN
• Sequence Length: 269-387aa; partial

• Species: Escherichia coli (strain K12)
• Tag: C-terminal 6xHis-tagged
• Transmembrane Domain: 2TM
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 degree C/-80 degree C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
• Preparation and Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 degree C/-80 degree C. The shelf life of lyophilized form is 12 months at -20 degree C/-80 degree C.; Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

SDS-PAGE

((Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.)

Related Product Information for fhuA recombinant protein

Involved in the uptake of iron in complex with ferrichrome, a hydroxamate-type siderophore. Binds and transports ferrichrome-iron across the outer membrane. In addition to its role in ferrichrome-iron transport, transports the antibiotic albomycin, which is a structural analog of ferrichrome, and acts as a receptor for colicin M, microcin J25 and bacteriophages T1, T5, phi80 and UC-1. The energy source, which is required for all FhuA functions except infection by phage T5, is provided by the inner membrane TonB system.

Product Categories/Family for fhuA recombinant protein

Others

NCBI and Uniprot Product Information

• NCBI GI #: 16128143
• NCBI GeneID: 944856
• NCBI Accession #: NP_414692.1
• NCBI GenBank Nucleotide #: NC_000913.3
• UniProt Accession #: P06971; P71280; P75665
• Molecular Weight: 82,182 Da
• NCBI Official Full Name: ferrichrome outer membrane transporter
• NCBI Official Symbol: fhuA
• NCBI Official Synonym Symbols: ECK0149; JW0146; T1; tonA
• NCBI Protein Information: ferrichrome outer membrane transporter
• UniProt Protein Name: Ferrichrome outer membrane transporter/phage receptor
• UniProt Gene Name: fhuA