SDS-PAGE
Frataxin, mitochondrial (Fxn) Recombinant Protein | Fxn recombinant protein
Recombinant Rat Frataxin, mitochondrial (Fxn)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Frataxin, mitochondrial (Fxn); N/A; Recombinant Rat Frataxin, mitochondrial (Fxn); Frataxin, mitochondrial; Fxn; EC=1.16.3.1Cleaved into the following 2 chains:; 1. Frataxin intermediate form; 2. Frataxin mature form; Fxn recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
41-208aa; Full Length of Mature Protein
Sequence
LHVTANADAIRHSHLNLHYLGQILNIKKQSVCVVHLRNSGTLGNPSSLDETAYERLAEETLDALAEFFEDLADKPYTLKDYDVSFGDGVLTIKLGGDLGTYVINKQTPLLYLWFSGPCSGPKRYDWTGKNWVYSHDGVSLHELLARELTEALNTKLDLSSLAYSGKGT
Sequence Length
208
Species
Rattus norvegicus (Rat)
Production Note
Special Offer: The E. coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E. coli host-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E. coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E. coli host-expressed protein for the fastest delivery among all hosts. Please or email to for more details.
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
SDS-PAGE
SDS-PAGE
Related Product Information for Fxn recombinant protein
Promotes the biosynthesis of heme and assembly and repair of iron-sulfur clusters by delivering Fe2+ to proteins involved in these pathways. May play a role in the protection against iron-catalyzed oxidative stress through its ability to catalyze the oxidation of Fe2+ to Fe3+; the oligomeric form but not the monomeric form has in vitro ferroxidase activity. May be able to store large amounts of iron in the form of a ferrihydrite mineral by oligomerization. Modulates the RNA-binding activity of ACO1
Product Categories/Family for Fxn recombinant protein
NCBI and Uniprot Product Information
Similar Products
Product Notes
The Fxn fxn (Catalog #AAA115810) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 41-208aa; Full Length of Mature Protein. The amino acid sequence is listed below: LHVTANADAI RHSHLNLHYL GQILNIKKQS VCVVHLRNSG TLGNPSSLDE TAYERLAEET LDALAEFFED LADKPYTLKD YDVSFGDGVL TIKLGGDLGT YVINKQTPLL YLWFSGPCSG PKRYDWTGKN WVYSHDGVSL HELLARELTE ALNTKLDLSS LAYSGKGT. It is sometimes possible for the material contained within the vial of "Frataxin, mitochondrial (Fxn), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.