WB (Western Blot)
(Host: RabbitTarget Name: FRDASample Tissue: Jurkat Cell LysateAntibody Dilution: 1.0 ug/ml)
FXN blocking peptide
FXN Peptide - C-terminal region
Gene Names
FXN; FA; X25; CyaY; FARR; FRDA
Reactivity
Reacts with: HumanPredicted reacts with: Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
FXN, Blocking Peptide; FXN Peptide - C-terminal region; FXN blocking peptide
Host
Rabbit
Reactivity
Reacts with: Human
Predicted reacts with: Human
Predicted reacts with: Human
Clonality
polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid; Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TPNKQIWLSSPSSGPKRYDWTGKNWVYSHDGVSLHELLAAELTKALKTKL
Sequence Length
210
Applicable Applications for FXN blocking peptide
WB (Western Blot)
Immunogen
Synthetic peptide directed towards the C-terminal region of Human FRDA.
RNA seq
Find tissue and cell lines supported by RNA-seq analysis to express FXN.
Preparation and Storage
For shorterm use: store at 2-8 degree C up to 1 week.
For long term: store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
For long term: store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(Host: RabbitTarget Name: FRDASample Tissue: Jurkat Cell LysateAntibody Dilution: 1.0 ug/ml)
WB (Western Blot)
(Host: RabbitTarget Name: FRDASample Tissue: Jurkat Cell LysateAntibody Dilution: 1.0 ug/ml)
Related Product Information for FXN blocking peptide
This nuclear gene encodes a mitochondrial protein which belongs to the FRATAXIN family. The protein functions in regulating mitochondrial iron transport and respiration. The expansion of intronic trinucleotide repeat GAA from 8-33 repeats to >90 repeats results in Friedreich ataxia. Alternative splicing results in multiple transcript variants.
Product Categories/Family for FXN blocking peptide
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
23kDa
NCBI Official Full Name
Frataxin, mitochondrial
NCBI Official Synonym Full Names
frataxin
NCBI Official Symbol
FXN
NCBI Official Synonym Symbols
FA; X25; CyaY; FARR; FRDA
NCBI Protein Information
frataxin, mitochondrial
UniProt Protein Name
Frataxin, mitochondrial
UniProt Gene Name
FXN
UniProt Synonym Gene Names
FRDA; X25; Fxn; i-FXN
UniProt Entry Name
FRDA_HUMAN
Similar Products
Product Notes
The FXN fxn (Catalog #AAA201858) is a Blocking Peptide produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FXN Peptide - C-terminal region reacts with Reacts with: Human Predicted reacts with: Human and may cross-react with other species as described in the data sheet. AAA Biotech's FXN can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the FXN fxn for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TPNKQIWLSS PSSGPKRYDW TGKNWVYSHD GVSLHELLAA ELTKALKTKL. It is sometimes possible for the material contained within the vial of "FXN, polyclonal Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.