Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA200822_WB11.jpg WB (Western Blot) (GPX4 antibody - middle region validated by WB using HepG2 cell lysate at 1.0ug/ml.GPX4 is supported by BioGPS gene expression data to be expressed in HepG2)

Rabbit GPX4 Polyclonal Antibody | anti-GPX4 antibody

GPX4 antibody - middle region

Average rating 0.0
No ratings yet
Gene Names
GPX4; MCSP; SMDS; GPx-4; PHGPx; snGPx; GSHPx-4; snPHGPx
Reactivity
Cow, Goat, Guinea Pig, Human, Mouse, Rat, Yeast, Zebrafish
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
GPX4, Antibody; GPX4 antibody - middle region; anti-GPX4 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Goat, Guinea Pig, Human, Mouse, Rat, Yeast, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QUGKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFAA
Sequence Length
197
Applicable Applications for anti-GPX4 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 86%; Goat: 86%; Guinea Pig: 86%; Human: 100%; Mouse: 86%; Rat: 86%; Yeast: 93%; Zebrafish: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human GPX4
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(GPX4 antibody - middle region validated by WB using HepG2 cell lysate at 1.0ug/ml.GPX4 is supported by BioGPS gene expression data to be expressed in HepG2)

product-image-AAA200822_WB11.jpg WB (Western Blot) (GPX4 antibody - middle region validated by WB using HepG2 cell lysate at 1.0ug/ml.GPX4 is supported by BioGPS gene expression data to be expressed in HepG2)

IHC (Immunohiostchemistry)

(Immunohistochemistry with Rat Brain lysate tissue)

product-image-AAA200822_IHC13.jpg IHC (Immunohiostchemistry) (Immunohistochemistry with Rat Brain lysate tissue)

IHC (Immunohistochemistry)

(Immunohistochemistry with formalin-fixed, paraffin-embedded human Heart tissue at an antibody concentration of 5.0ug/ml using anti-GPX4 antibody)

product-image-AAA200822_IHC15.jpg IHC (Immunohistochemistry) (Immunohistochemistry with formalin-fixed, paraffin-embedded human Heart tissue at an antibody concentration of 5.0ug/ml using anti-GPX4 antibody)
Related Product Information for anti-GPX4 antibody
This is a rabbit polyclonal antibody against GPX4. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Glutathione peroxidase catalyzes the reduction of hydrogen peroxide, organic hydroperoxide, and lipid peroxides by reduced glutathione and functions in the protection of cells against oxidative damage. Human plasma glutathione peroxidase has been shown to be a selenium-containing enzyme and the UGA codon is translated into a selenocysteine. Through alternative splicing and transcription initiation, rat produces proteins that localize to the nucleus, mitochondrion, and cytoplasm. In humans, experimental evidence for alternative splicing exists; alternative transcription initiation and the cleavage sites of the mitochondrial and nuclear transit peptides need to be experimentally verified.Glutathione peroxidase catalyzes the reduction of hydrogen peroxide, organic hydroperoxide, and lipid peroxides by reduced glutathione and functions in the protection of cells against oxidative damage. Human plasma glutathione peroxidase has been shown to be a selenium-containing enzyme and the UGA codon is translated into a selenocysteine. Through alternative splicing and transcription initiation, rat produces proteins that localize to the nucleus, mitochondrion, and cytoplasm. In humans, experimental evidence for alternative splicing exists; alternative transcription initiation and the cleavage sites of the mitochondrial and nuclear transit peptides need to be experimentally verified.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
22kDa
NCBI Official Full Name
phospholipid hydroperoxide glutathione peroxidase isoform A
NCBI Official Synonym Full Names
glutathione peroxidase 4
NCBI Official Symbol
GPX4
NCBI Official Synonym Symbols
MCSP; SMDS; GPx-4; PHGPx; snGPx; GSHPx-4; snPHGPx
NCBI Protein Information
phospholipid hydroperoxide glutathione peroxidase
UniProt Protein Name
Phospholipid hydroperoxide glutathione peroxidase, mitochondrial
UniProt Gene Name
GPX4
UniProt Synonym Gene Names
PHGPx; GPx-4; GSHPx-4
UniProt Entry Name
GPX4_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The GPX4 gpx4 (Catalog #AAA200822) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GPX4 antibody - middle region reacts with Cow, Goat, Guinea Pig, Human, Mouse, Rat, Yeast, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's GPX4 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the GPX4 gpx4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QUGKTEVNYT QLVDLHARYA ECGLRILAFP CNQFGKQEPG SNEEIKEFAA. It is sometimes possible for the material contained within the vial of "GPX4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.