Histone H2AX (H2AFX) Recombinant Protein | H2AFX recombinant protein

Recombinant Human Histone H2AX (H2AFX), partial

Cat. Num. AAA81752

• Gene Names: H2AFX; H2AX; H2A.X; H2A/X
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Histone H2AX (H2AFX); N/A; Recombinant Human Histone H2AX (H2AFX), partial; Histone H2A.X; H2AFX recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 12-141aa, Partial
• Sequence: RAKAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTSATVGPKAPSGGKKATQASQ

• Species: Homo sapiens (Human)
• Subcellular Location: Nucleus, Chromosome
• Protein Families: Histone H2A family
• Pathway: Necroptosis
• Relevance: Variant histone H2A which replaces conventional H2A in a subset of nucleosomes. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling. Required for checkpoint-mediated arrest of cell cycle progression in response to low doses of ionizing radiation and for efficient repair of DNA double strand breaks (DSBs) specifically when modified by C-terminal phosphorylation.
• Function: Variant histone H2A which replaces conventional H2A in a subset of nucleosomes. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling. Required for checkpoint-mediated arrest of cell cycle progression in response to low doses of ionizing radiation and for efficient repair of DNA double strand breaks (DSBs) specifically when modified by C-terminal phosphorylation.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 degree C/-80 degree C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
• Preparation and Storage: Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

Product Categories/Family for H2AFX recombinant protein

Epigenetics and Nuclear Signaling

References

"H2A.X. a histone isoprotein with a conserved C-terminal sequence, is encoded by a novel mRNA with both DNA replication type and polyA 3' processing signals."Mannironi C., Bonner W.M., Hatch C.L.Nucleic Acids Res. 17:9113-9126(1989)
https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=HGNC:4739
https://www.ncbi.nlm.nih.gov/UniGene/clust.cgi?ORG=Hs&CID=477879
https://www.genome.jp/dbget-bin/www_bget?hsa:3014
https://string-db.org/network/9606.ENSP00000364310
https://www.omim.org/entry/601772601772601772

NCBI and Uniprot Product Information

• NCBI GI #: 4504253
• NCBI GeneID: 3014
• NCBI Accession #: NP_002096.1
• NCBI GenBank Nucleotide #: NM_002105.2
• UniProt Accession #: P16104; Q4ZGJ7; Q6IAS5
• Molecular Weight: 15,145 Da
• NCBI Official Full Name: histone H2A.x
• NCBI Official Synonym Full Names: H2A histone family, member X
• NCBI Official Symbol: H2AFX
• NCBI Official Synonym Symbols: H2AX; H2A.X; H2A/X
• NCBI Protein Information: histone H2A.x; H2AX histone
• UniProt Protein Name: Histone H2A.x
• UniProt Gene Name: H2AFX
• UniProt Synonym Gene Names: H2AX; H2a/x
• UniProt Entry Name: H2AX_HUMAN