HLA class II histocompatibility antigen, DM beta chain (HLA-DMB) Recombinant Protein | HLA-DMB recombinant protein
Recombinant Human HLA class II histocompatibility antigen, DM beta chain (HLA-DMB), partial
Gene Names
HLA-DMB; RING7; D6S221E
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
HLA class II histocompatibility antigen, DM beta chain (HLA-DMB); N/A; Recombinant Human HLA class II histocompatibility antigen, DM beta chain (HLA-DMB), partial; HLA-DMB recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
19-218aa, Partial
Sequence
GGFVAHVESTCLLDDAGTPKDFTYCISFNKDLLTCWDPEENKMAPCEFGVLNSLANVLSQHLNQKDTLMQRLRNGLQNCATHTQPFWGSLTNRTRPPSVQVAKTTPFNTREPVMLACYVWGFYPAEVTITWRKNGKLVMPHSSAHKTAQPNGDWTYQTLSHLALTPSYGDTYTCVVEHIGAPEPILRDWTPGLSPMQTLK
Sequence Length
263
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for HLA-DMB recombinant protein
Plays a critical role in catalyzing the release of class II-associated invariant chain peptide (CLIP) from newly synthesized MHC class II molecules and freeing the peptide binding site for acquisition of antigenic peptides. In B-cells, the interaction between HLA-DM and MHC class II molecules is regulated by HLA-DO.
Product Categories/Family for HLA-DMB recombinant protein
References
"Genomic organization of HLA-DMA and HLA-DMB. Comparison of the gene organization of all six class II families in the human major histocompatibility complex." Radley E., Alderton R.P., Kelly A., Trowsdale J., Beck S. J. Biol. Chem. 269:18834-18838(1994)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
26.4 kDa
NCBI Official Full Name
HLA class II histocompatibility antigen, DM beta chain
NCBI Official Synonym Full Names
major histocompatibility complex, class II, DM beta
NCBI Official Symbol
HLA-DMB
NCBI Official Synonym Symbols
RING7; D6S221E
NCBI Protein Information
HLA class II histocompatibility antigen, DM beta chain
UniProt Protein Name
HLA class II histocompatibility antigen, DM beta chain
UniProt Gene Name
HLA-DMB
UniProt Synonym Gene Names
DMB; RING7
Similar Products
Product Notes
The HLA-DMB hla-dmb (Catalog #AAA114966) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 19-218aa, Partial. The amino acid sequence is listed below: GGFVAHVEST CLLDDAGTPK DFTYCISFNK DLLTCWDPEE NKMAPCEFGV LNSLANVLSQ HLNQKDTLMQ RLRNGLQNCA THTQPFWGSL TNRTRPPSVQ VAKTTPFNTR EPVMLACYVW GFYPAEVTIT WRKNGKLVMP HSSAHKTAQP NGDWTYQTLS HLALTPSYGD TYTCVVEHIG APEPILRDWT PGLSPMQTLK. It is sometimes possible for the material contained within the vial of "HLA class II histocompatibility antigen, DM beta chain (HLA-DMB), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.