Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA201188_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: HLA-DMBSample Type: Human PlacentaAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human, Rat HLA-DMB Polyclonal Antibody | anti-HLA-DMB antibody

HLA-DMB antibody - N-terminal region

Gene Names
HLA-DMB; RING7; D6S221E
Reactivity
Human, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
HLA-DMB, Antibody; HLA-DMB antibody - N-terminal region; anti-HLA-DMB antibody
Ordering
Host
Rabbit
Reactivity
Human, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: FTYCISFNKDLLTCWDPEENKMAPCEFGVLNSLANVLSQHLNQKDTLMQR
Sequence Length
263
Applicable Applications for anti-HLA-DMB antibody
IHC (Immunohistochemistry), WB (Western Blot)
Homology
Human: 100%; Rat: 86%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(Host: RabbitTarget Name: HLA-DMBSample Type: Human PlacentaAntibody Dilution: 1.0ug/ml)

product-image-AAA201188_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: HLA-DMBSample Type: Human PlacentaAntibody Dilution: 1.0ug/ml)

IHC (Immunohistochemistry)

(Rabbit Anti-HLA-DMB AntibodyFormalin Fixed Paraffin Embedded Tissue: Human heart TissueObserved Staining: Plasma membrane in intercalated diskPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

product-image-AAA201188_IHC15.jpg IHC (Immunohistochemistry) (Rabbit Anti-HLA-DMB AntibodyFormalin Fixed Paraffin Embedded Tissue: Human heart TissueObserved Staining: Plasma membrane in intercalated diskPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
Related Product Information for anti-HLA-DMB antibody
This is a rabbit polyclonal antibody against HLA-DMB. It was validated on Western Blot

Target Description: HLA-DMB belongs to the HLA class II beta chain paralogues. This class II molecule is a heterodimer consisting of an alpha (DMA) and a beta (DMB) chain, both anchored in the membrane. It is located in intracellular vesicles. DM plays a central role in the peptide loading of MHC class II molecules by helping to release the CLIP (class II-associated invariant chain peptide) molecule from the peptide binding site. Class II molecules are expressed in antigen presenting cells (APC: B lymphocytes, dendritic cells, macrophages). The beta chain is approximately 26-28 kDa and its gene contains 6 exons. Exon one encodes the leader peptide, exons 2 and 3 encode the two extracellular domains, exon 4 encodes the transmembrane domain and exon 5 encodes the cytoplasmic tail.
Product Categories/Family for anti-HLA-DMB antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
29kDa
NCBI Official Full Name
HLA class II histocompatibility antigen, DM beta chain
NCBI Official Synonym Full Names
major histocompatibility complex, class II, DM beta
NCBI Official Symbol
HLA-DMB
NCBI Official Synonym Symbols
RING7; D6S221E
NCBI Protein Information
HLA class II histocompatibility antigen, DM beta chain
UniProt Protein Name
HLA class II histocompatibility antigen, DM beta chain
UniProt Gene Name
HLA-DMB
UniProt Synonym Gene Names
DMB; RING7
UniProt Entry Name
DMB_HUMAN

Similar Products

Product Notes

The HLA-DMB hla-dmb (Catalog #AAA201188) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HLA-DMB antibody - N-terminal region reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's HLA-DMB can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the HLA-DMB hla-dmb for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FTYCISFNKD LLTCWDPEEN KMAPCEFGVL NSLANVLSQH LNQKDTLMQR. It is sometimes possible for the material contained within the vial of "HLA-DMB, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.