ATRX blocking peptide
ATRX Peptide - C-terminal region
Gene Names
ATRX; JMS; XH2; XNP; MRX52; RAD54; RAD54L; ZNF-HX
Reactivity
Human
Applications
Western Blot
Synonyms
ATRX; N/A; ATRX Peptide - C-terminal region; ATRX blocking peptide
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: DQSDETSEDDKKQSKKGTEEKKKPSDFKKKVIKMEQQYESSSDGTEKLPE
Sequence Length
1350
Applicable Applications for ATRX blocking peptide
WB (Western Blot)
Protein Size
1350 amino acids
Quality Control
The peptide is characterized by mass spectrometry.
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for ATRX blocking peptide
This is a synthetic peptide designed for use in combination with anti-ATRX Antibody, made
Target Description: The protein encoded by this gene contains an ATPase/helicase domain, and thus it belongs to the SWI/SNF family of chromatin remodeling proteins. The mutations of this gene are associated with an X-linked mental retardation (XLMR) syndrome most often accompanied by alpha-thalassemia (ATRX) syndrome. These mutations have been shown to cause diverse changes in the pattern of DNA methylation, which may provide a link between chromatin remodeling, DNA methylation, and gene expression in developmental processes. This protein is found to undergo cell cycle-dependent phosphorylation, which regulates its nuclear matrix and chromatin association, and suggests its involvement in the gene regulation at interphase and chromosomal segregation in mitosis. Multiple alternatively spliced transcript variants encoding distinct isoforms have been reported.
Target Description: The protein encoded by this gene contains an ATPase/helicase domain, and thus it belongs to the SWI/SNF family of chromatin remodeling proteins. The mutations of this gene are associated with an X-linked mental retardation (XLMR) syndrome most often accompanied by alpha-thalassemia (ATRX) syndrome. These mutations have been shown to cause diverse changes in the pattern of DNA methylation, which may provide a link between chromatin remodeling, DNA methylation, and gene expression in developmental processes. This protein is found to undergo cell cycle-dependent phosphorylation, which regulates its nuclear matrix and chromatin association, and suggests its involvement in the gene regulation at interphase and chromosomal segregation in mitosis. Multiple alternatively spliced transcript variants encoding distinct isoforms have been reported.
Product Categories/Family for ATRX blocking peptide
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
148kDa
NCBI Official Full Name
transcriptional regulator ATRX isoform 1
NCBI Official Synonym Full Names
ATRX chromatin remodeler
NCBI Official Symbol
ATRX
NCBI Official Synonym Symbols
JMS; XH2; XNP; MRX52; RAD54; RAD54L; ZNF-HX
NCBI Protein Information
transcriptional regulator ATRX
UniProt Protein Name
Transcriptional regulator ATRX
UniProt Gene Name
ATRX
UniProt Synonym Gene Names
RAD54L; XH2; XNP
UniProt Entry Name
ATRX_HUMAN
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The ATRX atrx (Catalog #AAA201829) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The ATRX Peptide - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ATRX can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the ATRX atrx for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DQSDETSEDD KKQSKKGTEE KKKPSDFKKK VIKMEQQYES SSDGTEKLPE. It is sometimes possible for the material contained within the vial of "ATRX, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.