PSEN1 blocking peptide
PSEN1 Peptide - N-terminal region
Gene Names
PSEN1; AD3; FAD; PS1; PS-1; S182; ACNINV3
Reactivity
Human
Synonyms
PSEN1; N/A; PSEN1 Peptide - N-terminal region; PSEN1 blocking peptide
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: GNSRQVVEQDEEEDEELTLKYGAKHVIMLFVPVTLCMVVVVATIKSVSFY
Sequence Length
467
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for PSEN1 blocking peptide
This is a synthetic peptide designed for use in combination with anti- PSEN1 Antibody, made
Target Description: Alzheimer's disease (AD) patients with an inherited form of the disease carry mutations in the presenilin proteins (PSEN1; PSEN2) or in the amyloid precursor protein (APP). These disease-linked mutations result in increased production of the longer form of amyloid-beta (main component of amyloid deposits found in AD brains). Presenilins are postulated to regulate APP processing through their effects on gamma-secretase, an enzyme that cleaves APP. Also, it is thought that the presenilins are involved in the cleavage of the Notch receptor, such that they either directly regulate gamma-secretase activity or themselves are protease enzymes. Several alternatively spliced transcript variants encoding different isoforms have been identified for this gene, the full-length nature of only some have been determined.Â
Target Description: Alzheimer's disease (AD) patients with an inherited form of the disease carry mutations in the presenilin proteins (PSEN1; PSEN2) or in the amyloid precursor protein (APP). These disease-linked mutations result in increased production of the longer form of amyloid-beta (main component of amyloid deposits found in AD brains). Presenilins are postulated to regulate APP processing through their effects on gamma-secretase, an enzyme that cleaves APP. Also, it is thought that the presenilins are involved in the cleavage of the Notch receptor, such that they either directly regulate gamma-secretase activity or themselves are protease enzymes. Several alternatively spliced transcript variants encoding different isoforms have been identified for this gene, the full-length nature of only some have been determined.Â
Product Categories/Family for PSEN1 blocking peptide
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
53 kDa
NCBI Official Full Name
presenilin-1 isoform I-467
NCBI Official Synonym Full Names
presenilin 1
NCBI Official Symbol
PSEN1
NCBI Official Synonym Symbols
AD3; FAD; PS1; PS-1; S182; ACNINV3
NCBI Protein Information
presenilin-1
UniProt Protein Name
Presenilin-1
UniProt Gene Name
PSEN1
UniProt Synonym Gene Names
AD3; PS1; PSNL1; PS-1; PS1-CTF12
UniProt Entry Name
PSN1_HUMAN
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The PSEN1 psen1 (Catalog #AAA201864) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The PSEN1 Peptide - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: GNSRQVVEQD EEEDEELTLK YGAKHVIMLF VPVTLCMVVV VATIKSVSFY. It is sometimes possible for the material contained within the vial of "PSEN1, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.