Application Data
(Recombinant Human IL-12/IL-12A&IL-12B Protein induce Interferon gamma secretion by human natural killer lymphoma NK-92 cells. The ED<sub>50</sub> for this effect is 0.94-3.75 ng/mL, corresponding to a specific activity of 2.67×10<sup>5</sup>~1.06×10<sup>6</sup> units/mg.)
IL-12/IL-12A&IL-12B Recombinant Protein | IL12 recombinant protein
Recombinant Human IL-12/IL-12A&IL-12B Protein
Synonyms
IL-12/IL-12A&IL-12B; N/A; Recombinant Human IL-12/IL-12A&IL-12B Protein; CLMF, IL12, p70, Interleukin-12, IL12A, P35, NKSF; IL12 recombinant protein
Host
HEK293 cells
Form/Format
Lyophilized from a 0.22 um filtered solution of PBS, pH7.4.
Sequence
IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCSGGGGSRNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS
Species
Human
Tag
C-His
Endotoxin
<0.01EU/ug of the protein by LAL method.
Bio-Activity
Measured by its ability to induce Interferon gamma secretion by human natural killer lymphoma NK-92 cells. The ED50 for this effect is 0.94-3.75ng/mL, corresponding to a specific activity of 2.67×105~1.06×106 units/mg.
Preparation and Storage
Store at -20 degree C. Store the lyophilized protein at -20 degree C to -80 degree C up to 1 year from the date of receipt.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.
Application Data
(Recombinant Human IL-12/IL-12A&IL-12B Protein induce Interferon gamma secretion by human natural killer lymphoma NK-92 cells. The ED<sub>50</sub> for this effect is 0.94-3.75 ng/mL, corresponding to a specific activity of 2.67×10<sup>5</sup>~1.06×10<sup>6</sup> units/mg.)
Application Data
(Recombinant Human IL-12/IL-12A&IL-12B Protein induce Interferon gamma secretion by human natural killer lymphoma NK-92 cells. The ED<sub>50</sub> for this effect is 0.94-3.75 ng/mL, corresponding to a specific activity of 2.67×10<sup>5</sup>~1.06×10<sup>6</sup> units/mg.)
SDS-PAGE
(Recombinant Human IL-12/IL-12A&IL-12B Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 60-75kDa.)
SDS-PAGE
(Recombinant Human IL-12/IL-12A&IL-12B Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 60-75kDa.)
Product Categories/Family for IL12 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Protein Name
Interleukin-12 subunit alpha
UniProt Gene Name
IL12A
UniProt Synonym Gene Names
NKSF1; IL-12A; CLMF p35; NKSF1
UniProt Entry Name
IL12A_HUMAN
Similar Products
Product Notes
The IL12 il12a (Catalog #AAA283360) is a Recombinant Protein produced from HEK293 cells and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: IWELKKDVYV VELDWYPDAP GEMVVLTCDT PEEDGITWTL DQSSEVLGSG KTLTIQVKEF GDAGQYTCHK GGEVLSHSLL LLHKKEDGIW STDILKDQKE PKNKTFLRCE AKNYSGRFTC WWLTTISTDL TFSVKSSRGS SDPQGVTCGA ATLSAERVRG DNKEYEYSVE CQEDSACPAA EESLPIEVMV DAVHKLKYEN YTSSFFIRDI IKPDPPKNLQ LKPLKNSRQV EVSWEYPDTW STPHSYFSLT FCVQVQGKSK REKKDRVFTD KTSATVICRK NASISVRAQD RYYSSSWSEW ASVPCSGGGG SRNLPVATPD PGMFPCLHHS QNLLRAVSNM LQKARQTLEF YPCTSEEIDH EDITKDKTST VEACLPLELT KNESCLNSRE TSFITNGSCL ASRKTSFMMA LCLSSIYEDL KMYQVEFKTM NAKLLMDPKR QIFLDQNMLA VIDELMQALN FNSETVPQKS SLEEPDFYKT KIKLCILLHA FRIRAVTIDR VMSYLNAS. It is sometimes possible for the material contained within the vial of "IL-12/IL-12A&IL-12B, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.