Interleukin-23 subunit alpha (IL23A) Recombinant Protein | IL23A recombinant protein
Recombinant Pig Interleukin-23 subunit alpha (IL23A)
Gene Names
IL23A; SGRF; il23p19
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Interleukin-23 subunit alpha (IL23A); N/A; Recombinant Pig Interleukin-23 subunit alpha (IL23A); IL23A recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
23-193, Full length protein
Sequence
RAVPEGSSPAWAQGQQLSQQLCTLAWTAHLPMGHVDLPREEGDDETTSEVPHIQCGDGCDPQGLRDNSQSCLQRIHQGLVFYEKLLGSDIFTGEPSLHPDGSVGQLHASLLGLRQLLQPEGHHWETEQTPSPSPSQPWQRLLLRLKILRSLQAFVAVAARVFAHGAATLSQ
Sequence Length
171
Species
Sus scrofa (Pig)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for IL23A recombinant protein
This gene encodes a subunit of the heterodimeric cytokine interleukin 23 (IL23). IL23 is composed of this protein and the p40 subunit of interleukin 12 (IL12B). The receptor of IL23 is formed by the beta 1 subunit of IL12 (IL12RB1) and an IL23 specific subunit, IL23R. Both IL23 and IL12 can activate the transcription activator STAT4, and stimulate the production of interferon-gamma (IFNG). In contrast to IL12, which acts mainly on naive CD4(+) T cells, IL23 preferentially acts on memory CD4(+) T cells.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
21,132 Da
NCBI Official Full Name
interleukin-23 subunit alpha
NCBI Official Symbol
IL23A
NCBI Official Synonym Symbols
SGRF; il23p19
NCBI Protein Information
interleukin-23 subunit alpha
UniProt Protein Name
Interleukin-23 subunit alpha
UniProt Gene Name
IL23A
UniProt Synonym Gene Names
SGRF; IL-23 subunit alpha; IL-23-A; IL-23p19
Similar Products
Product Notes
The IL23A il23a (Catalog #AAA116864) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 23-193, Full length protein. The amino acid sequence is listed below: RAVPEGSSPA WAQGQQLSQQ LCTLAWTAHL PMGHVDLPRE EGDDETTSEV PHIQCGDGCD PQGLRDNSQS CLQRIHQGLV FYEKLLGSDI FTGEPSLHPD GSVGQLHASL LGLRQLLQPE GHHWETEQTP SPSPSQPWQR LLLRLKILRS LQAFVAVAAR VFAHGAATLS Q. It is sometimes possible for the material contained within the vial of "Interleukin-23 subunit alpha (IL23A), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.