IL-17E Recombinant Protein | IL17E recombinant protein

Recombinant Mouse IL-17E Protein

Cat. Num. AAA283369

• Purity: >92% by SDS-PAGE.
• Synonyms: IL-17E; N/A; Recombinant Mouse IL-17E Protein; IL-25; Il17e; IL-17e; IL17E recombinant protein

• Host: HEK293 cells
• Purity/Purification: >92% by SDS-PAGE.
• Form/Format: Lyophilized from a 0.22 um filtered solution of PBS, pH7.4.
• Sequence: VSLRIQEGCSHLPSCCPSKEQEPPEEWLKWSSASVSPPEPLSHTHHAESCRASKDGPLNSRAISPWSYELDRDLNRVPQDLYHARCLCPHCVSLQTGSHMDPLGNSVPLYHNQTVFYRRPCHGEEGTHRRYCLERRLYRVSLACVCVRPRVMA

• Species: Mouse
• Tag: N-His
• Endotoxin: <0.01EU/ug
• Bio-Activity: Measured by its ability to induce CXCL1/GRO alpha secretion in HT-29 human colon adenocarcinoma cells. The ED₅₀ for this effect is 0.96-3.83ng/mL, corresponding to a specific activity of 2.61×10⁵~1.04×10⁶ units/mg.
• Preparation and Storage: Store at -20 degree C. Store the lyophilized protein at -20 degree C to -80 degree C up to 1 year from the date of receipt.; After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.

Application Data

(Recombinant Mouse IL-17E induce CXCL1/GRO alpha secretion in HT-29 human colon adenocarcinoma cells. The ED₅₀ for this effect is 0.96-3.83 ng/mL, corresponding to a specific activity of 2.61×10⁵~1.04×10⁶ units/mg.)

SDS-PAGE

(Recombinant Mouse IL-17E Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 26 kDa.)

Related Product Information for IL17E recombinant protein

Interleukin-25 (IL-25) is a cytokine that shares sequence similarity with interleukin 17. This cytokine can induce NF-kappaB activation, and stimulate the production of interleukin 8. Both this cytokine and interleukin 17B are ligands for the cytokine receptor IL17BR. IL-25 is a member of the IL-17 family of cytokines. However, unlike the other members of this family, IL-25 promotes T helper (Th) 2 responses. IL-25 also regulates the development of autoimmune inflammation mediated by IL-17-producing T cells. IL-25 and IL-17, being members of the same cytokine family, play opposing roles in the pathogenesis of organ-specific autoimmunity. IL-25 promotes cell expansion and Th2 cytokine production when Th2 central memory cells are stimulated with thymic stromal lymphopoietin (TSLP)-activated dendritic cells (DCs), homeostatic cytokines, or T cell receptor for antigen triggering. Elevated expression of IL-25 and IL-25R transcripts was observed in asthmatic lung tissues and atopic dermatitis skin lesions, linking their possible roles with exacerbated allergic disorders. A plausible explanation that IL-25 produced by innate effector eosinophils and basophils may augment the allergic inflammation by enhancing the maintenance and functions of adaptive Th2 memory cells had been provided.

Product Categories/Family for IL17E recombinant protein

Cytokines & Cytokine receptors; Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 18141561
• NCBI GeneID: 140806
• NCBI Accession #: NP_542767.1
• NCBI GenBank Nucleotide #: NM_080729.3
• UniProt Accession #: Q8VHH8
• UniProt Protein Name: IL25
• UniProt Gene Name: Il25
• UniProt Entry Name: Q8VHH8_MOUSE