Interferon regulatory factor 8 Recombinant Protein | Irf8 recombinant protein
Recombinant Mouse Interferon regulatory factor 8
Gene Names
Irf8; Myls; ICSBP; IRF-8; Icsbp1; AI893568
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Interferon regulatory factor 8; N/A; Recombinant Mouse Interferon regulatory factor 8; Interferon consensus sequence-binding protein; ICSBP; Irf8 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-424aa; Full Length
Sequence
MCDRNGGRRLRQWLIEQIDSSMYPGLIWENDEKTMFRIPWKHAGKQDYNQEVDASIFKAWAVFKGKFKEGDKAEPATWKTRLRCALNKSPDFEEVTDRSQLDISEPYKVYRIVPEEEQKCKLGVAPAGCMSEVPEMECGRSEIEELIKEPSVDEYMGMTKRSPSPPEACRSQILPDWWVQQPSAGLPLVTGYAAYDTHHSAFSQMVISFYYGGKLVGQATTTCLEGCRLSLSQPGLPKLYGPDGLEPVCFPTADTIPSERQRQVTRKLFGHLERGVLLHSNRKGVFVKRLCQGRVFCSGNAVVCKGRPNKLERDEVVQVFDTNQFIRELQQFYATQSRLPDSRVVLCFGEEFPDTVPLRSKLILVQVEQLYARQLVEEAGKSCGAGSLMPALEEPQPDQAFRMFPDICTSHQRPFFRENQQITV
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Related Product Information for Irf8 recombinant protein
Specifically binds to the upstream regulatory region of type I IFN and IFN-inducible MHC class I genes (the interferon consensus sequence (ICS)). Plays a regulatory role in cells of the immune system. Involved in CD8+ dendritic cell differentiation by forming a complex with the BATF-JUNB heterodimer in immune cells, leading to recognition of AICE sequence (5'-TGAnTCA/GAAA-3'), an immune-specific regulatory element, followed by cooperative binding of BATF and IRF8 and activation of genes.
References
An interferon gamma-regulated protein that binds the interferon-inducible enhancer element of major histocompatibility complex class I genes.Driggers P.H., Ennist D.L., Gleason S.L., Mak W.-H., Marks M.S., Levi B.-Z., Flanagan J.R., Appella E., Ozato K.Proc. Natl. Acad. Sci. U.S.A. 87:3743-3747(1990) Autoantigen Ro52 is an interferon inducible E3 ligase that ubiquitinates IRF-8 and enhances cytokine expression in macrophages.Kong H.J., Anderson D.E., Lee C.H., Jang M.K., Tamura T., Tailor P., Cho H.K., Cheong J., Xiong H., Morse H.C. III, Ozato K.J. Immunol. 179:26-30(2007) Compensatory dendritic cell development mediated by BATF-IRF interactions.Tussiwand R., Lee W.L., Murphy T.L., Mashayekhi M., Kc W., Albring J.C., Satpathy A.T., Rotondo J.A., Edelson B.T., Kretzer N.M., Wu X., Weiss L.A., Glasmacher E., Li P., Liao W., Behnke M., Lam S.S., Aurthur C.T., Leonard W.J., Singh H., Stallings C.L., Sibley L.D., Schreiber R.D., Murphy K.M.Nature 490:502-507(2012)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
64.2 kDa
NCBI Official Full Name
interferon regulatory factor 8
NCBI Official Synonym Full Names
interferon regulatory factor 8
NCBI Official Symbol
Irf8
NCBI Official Synonym Symbols
Myls; ICSBP; IRF-8; Icsbp1; AI893568
NCBI Protein Information
interferon regulatory factor 8
UniProt Protein Name
Interferon regulatory factor 8
UniProt Gene Name
Irf8
UniProt Synonym Gene Names
Icsbp; Icsbp1; IRF-8; ICSBP
UniProt Entry Name
IRF8_MOUSE
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The Irf8 irf8 (Catalog #AAA113235) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-424aa; Full Length. The amino acid sequence is listed below: MCDRNGGRRL RQWLIEQIDS SMYPGLIWEN DEKTMFRIPW KHAGKQDYNQ EVDASIFKAW AVFKGKFKEG DKAEPATWKT RLRCALNKSP DFEEVTDRSQ LDISEPYKVY RIVPEEEQKC KLGVAPAGCM SEVPEMECGR SEIEELIKEP SVDEYMGMTK RSPSPPEACR SQILPDWWVQ QPSAGLPLVT GYAAYDTHHS AFSQMVISFY YGGKLVGQAT TTCLEGCRLS LSQPGLPKLY GPDGLEPVCF PTADTIPSER QRQVTRKLFG HLERGVLLHS NRKGVFVKRL CQGRVFCSGN AVVCKGRPNK LERDEVVQVF DTNQFIRELQ QFYATQSRLP DSRVVLCFGE EFPDTVPLRS KLILVQVEQL YARQLVEEAG KSCGAGSLMP ALEEPQPDQA FRMFPDICTS HQRPFFRENQ QITV. It is sometimes possible for the material contained within the vial of "Interferon regulatory factor 8, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
