SDS-PAGE
Integrin alpha-L Recombinant Protein | Itgal recombinant protein
Recombinant Mouse Integrin alpha-L
Gene Names
Itgal; Cd11a; LFA-1; Ly-15; Ly-21; (p180); LFA-1A
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Integrin alpha-L; N/A; Recombinant Mouse Integrin alpha-L; CD11 antigen-like family member A; Leukocyte adhesion glycoprotein LFA-1 alpha chain; LFA-1A; Leukocyte function-associated molecule 1 alpha chain; Lymphocyte antigen 15; Ly-15; CD11a; Itgal recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
153-325aa; Partial
Sequence
DLVFLFDGSQSLDRKDFEKILEFMKDVMRKLSNTSYQFAAVQFSTDCRTEFTFLDYVKQNKNPDVLLGSVQPMFLLTNTFRAINYVVAHVFKEESGARPDATKVLVIITDGEASDKGNISAAHDITRYIIGIGKHFVSVQKQKTLHIFASEPVEEFVKILDTFEKLKDLFTDL
Sequence Length
1163
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
SDS-PAGE
SDS-PAGE
Related Product Information for Itgal recombinant protein
Integrin alpha-L/beta-2 is a receptor for ICAM1, ICAM2, ICAM3 and ICAM4. Is involved in a variety of immune phenomena including leukocyte-endothelial cell interaction, cytotoxic T-cell mediated killing, and antibody dependent killing by granulocytes and monocytes. Mice expressing a null mutation of the alpha-L subunit gene donstrate impaired tumor rejection and impaired leukocytes recruitment.
References
Cloning of the murine lymphocyte function-associated molecule-1 alpha-subunit and its expression in COS cells.Kaufmann Y., Tseng E., Springer T.A.J. Immunol. 147:369-374(1991) Lineage-specific biology revealed by a finished genome assembly of the mouse.Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S., She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W., Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T., Zhou S., Teague B., Potamousis K., Churas C., Place M., Herschleb J., Runnheim R., Forrest D., Amos-Landgraf J., Schwartz D.C., Cheng Z., Lindblad-Toh K., Eichler E.E., Ponting C.P.PLoS Biol. 7:E1000112-E1000112(2009) Sequence homology of the LFA-1 and Mac-1 leukocyte adhesion glycoproteins and unexpected relation to leukocyte interferon.Springer T.A., Teplow D.B., Dreyer W.J.Nature 314:540-542(1985)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
21.7 kDa
NCBI Official Full Name
Integrin alpha-L
NCBI Official Synonym Full Names
integrin alpha L
NCBI Official Symbol
Itgal
NCBI Official Synonym Symbols
Cd11a; LFA-1; Ly-15; Ly-21; (p180); LFA-1A
NCBI Protein Information
integrin alpha-L
UniProt Protein Name
Integrin alpha-L
UniProt Gene Name
Itgal
UniProt Synonym Gene Names
Lfa-1; Ly-15; LFA-1A; Ly-15
UniProt Entry Name
ITAL_MOUSE
Similar Products
Product Notes
The Itgal itgal (Catalog #AAA114118) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 153-325aa; Partial. The amino acid sequence is listed below: DLVFLFDGSQ SLDRKDFEKI LEFMKDVMRK LSNTSYQFAA VQFSTDCRTE FTFLDYVKQN KNPDVLLGSV QPMFLLTNTF RAINYVVAHV FKEESGARPD ATKVLVIITD GEASDKGNIS AAHDITRYII GIGKHFVSVQ KQKTLHIFAS EPVEEFVKIL DTFEKLKDLF TDL. It is sometimes possible for the material contained within the vial of "Integrin alpha-L, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.