Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA79327_SDS_PAGE15.jpg SDS-PAGE (SDS-PAGE analysis of recombinant pLDH from Plasmodium falciparum produced in insect cellsafter cleavage of the GST-tag. Sample was loaded in 12.5% SDS-polyacrylamide gel under reducing condition and stained with Coomassie blue.)

LDH recombinant protein

Human LDH (Plasmodium falciparum)

Average rating 0.0
No ratings yet
Applications
ELISA
Purity
~71% by SDS-PAGE & Coomassie bluestaining
Synonyms
LDH; N/A; Human LDH (Plasmodium falciparum); LDH (Plasmodium falciparum); lactate dehydrogenase; LDH recombinant protein
Ordering
Host
Insect cells
Purity/Purification
~71% by SDS-PAGE & Coomassie bluestaining
Form/Format
Liquid; 50 mM Tris, 250 mM NaCl, 1 mM EDTA, pH8.0
Concentration
28ug/ml (varies by lot)
Sequence
PLAMAPKAKIVLVGSGMIGGVMATLIVQKNLGDVVLFDIVKNMPHGKALDTSHTNVMAYSNCKVSGSNTYDDLAGADVVIVTAGFTKAPGKSDKEWNRDDLLPLNNKIMIEIGGHIKKNCPNAFIIVVTNPVDVMVQLLHQHSGVPKNKIIGLGGVLDTSRLKYYISQKLNVCPRDVNAHIVGAHGNKMVLLKRYITVGGIPLQEFINNKLISDAELEAIFDRTVNTALEIVNLHASPYVAPAAAIIEMAESYLKDLKKVLICSTLLEGQYGHSDIFGGTPVVLGANGVEQVIELQLNSEEKAKFDEAIAETKRMKALA
Sequence Length
N/A319(without GST-tag)
Applicable Applications for LDH recombinant protein
ELISA
mRNA RefSeq
AF251291.1
Protein RefSeq
AAG14292.1
Length (aa)
319 (Without GST-tag)
Preparation and Storage
According to the available data the liquid protein stored at 4-8°C is stable at least for about 10 months.
Avoid repeated freeze/thaw cycles.

SDS-PAGE

(SDS-PAGE analysis of recombinant pLDH from Plasmodium falciparum produced in insect cellsafter cleavage of the GST-tag. Sample was loaded in 12.5% SDS-polyacrylamide gel under reducing condition and stained with Coomassie blue.)

product-image-AAA79327_SDS_PAGE15.jpg SDS-PAGE (SDS-PAGE analysis of recombinant pLDH from Plasmodium falciparum produced in insect cellsafter cleavage of the GST-tag. Sample was loaded in 12.5% SDS-polyacrylamide gel under reducing condition and stained with Coomassie blue.)
Related Product Information for LDH recombinant protein
Malaria is one of the most widespread infectious diseases affecting some 500 million people with an enormous cost in human suffering and economic hardship. Effective treatment of the disease is increasingly compromised by rising resistance of malaria parasites to currently available anti-malarials. The parasites are homolactate fermenters and rely on glycolysis for energy generation since the parasites appear to lack a functional citric acid cycle. The NAD+ consumed during glycolysis is reduced to NADH by lactate which, in turn, is oxidized to pyruvate. This reaction is catalyzed by lactate dehydrogenase (LDH). It has been demonstrated that inhibitors of this enzyme have parasiticidal activity. Since LDH from the malaria parasite Plasmodium falciparum (PfLDH) has notable structural and kinetic differences from human LDHs, the enzyme appears to be an attractive target for novel anti-malarial therapeutics. The parasite, P. falciparum, is the most lethal of malarial plasmodia being responsible for the cerebral form of the disease; consequently it has been the major focus of initial biochemical and genomic investigation. On the other hand, the parasite P. vivax is of great importance as it is the most widespread and common of the malarial plasmodia and, therefore, is responsible for the greatest burden of disease.
Product Categories/Family for LDH recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
UniProt Accession #
Molecular Weight
~35kDa
NCBI Official Full Name
L-lactate dehydrogenase
UniProt Protein Name
L-lactate dehydrogenase
UniProt Gene Name
LDH-P

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The LDH ldh-p (Catalog #AAA79327) is a Recombinant Protein produced from Insect cells and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's LDH can be used in a range of immunoassay formats including, but not limited to, ELISA. Researchers should empirically determine the suitability of the LDH ldh-p for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: PLAMAPKAKI VLVGSGMIGG VMATLIVQKN LGDVVLFDIV KNMPHGKALD TSHTNVMAYS NCKVSGSNTY DDLAGADVVI VTAGFTKAPG KSDKEWNRDD LLPLNNKIMI EIGGHIKKNC PNAFIIVVTN PVDVMVQLLH QHSGVPKNKI IGLGGVLDTS RLKYYISQKL NVCPRDVNAH IVGAHGNKMV LLKRYITVGG IPLQEFINNK LISDAELEAI FDRTVNTALE IVNLHASPYV APAAAIIEMA ESYLKDLKKV LICSTLLEGQ YGHSDIFGGT PVVLGANGVE QVIELQLNSE EKAKFDEAIA ETKRMKALA. It is sometimes possible for the material contained within the vial of "LDH, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.