Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA279251_BIOACTIVITY13.jpg Bioactivity (Measured by its binding ability in a functional ELISA. Immobilized Human BTLA at 2?g/mL can bind Anti-BTLA recombinant antibody, the EC50 is 11.56-13.00 ng/mL.)

B- and T-lymphocyte attenuator (BTLA) Active Protein | BTLA active protein

Recombinant Human B- and T-lymphocyte attenuator (BTLA), partial (Active)

Average rating 0.0
No ratings yet
Gene Names
BTLA; BTLA1; CD272
Purity
Greater than 95% as determined by SDS-PAGE.
Synonyms
B- and T-lymphocyte attenuator (BTLA); N/A; Recombinant Human B- and T-lymphocyte attenuator (BTLA), partial (Active); BTLA active protein
Ordering
Host
Mammalian Cell
Purity/Purification
Greater than 95% as determined by SDS-PAGE.
Form/Format
Lyophilized powder
Lyophilized from a 0.2 um filtered PBS, 6% Trehalose, pH 7.4
Sequence Positions
31-157aa; Partial (Extracellular Domain)
Sequence
KESCDVQLYIKRQSEHSILAGDPFELECPVKYCANRPHVTWCKLNGTTCVKLEDRQTSWKEEKNISFFILHFEPVLPNDNGSYRCSANFQSNLIESHSTTLYVTDVKSASERPSKDEMASRPWLLYR
Species
Homo sapiens (Human)
Tag
C-terminal 10xHis-tagged
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Research Area
Cancer
Biological Activity
Measured by its binding ability in a functional ELISA. Immobilized Human BTLA at 2 ug/mL can bind Anti-BTLA recombinant antibody. The EC50 is 11.56-13.00 ng/mL.
Preparation and Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 degree C/-80 degree C. The shelf life of lyophilized form is 12 months at -20 degree C/-80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 degree C/-80 degree C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Bioactivity

(Measured by its binding ability in a functional ELISA. Immobilized Human BTLA at 2?g/mL can bind Anti-BTLA recombinant antibody, the EC50 is 11.56-13.00 ng/mL.)

product-image-AAA279251_BIOACTIVITY13.jpg Bioactivity (Measured by its binding ability in a functional ELISA. Immobilized Human BTLA at 2?g/mL can bind Anti-BTLA recombinant antibody, the EC50 is 11.56-13.00 ng/mL.)

SDS-PAGE

((Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.)

product-image-AAA279251_SDS_PAGE15.jpg SDS-PAGE ((Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.)
Related Product Information for BTLA active protein
Inhibitory receptor on lymphocytes that negatively regulates antigen receptor signaling via PTPN6/SHP-1 and PTPN11/SHP-2.May interact in cis (on the same cell) or in trans (on other cells) with TNFRSF14.
Product Categories/Family for BTLA active protein
References
"Point mutations in the BTLA gene in multiple myeloma and other hematologic malignancies."Mao Y., Wang X., Wu H., Chen Y., Ge Y., Chen J., Zhang X.Submitted to EMBL/GenBank/DDBJ databases (APR-2004)"The DNA sequence, annotation and analysis of human chromosome 3."Muzny D.M., Scherer S.E., Kaul R., Wang J., Yu J., Sudbrak R., Buhay C.J., Chen R., Cree A., Gibbs R.A.Nature 440:1194-1198 (2006)"Complete sequencing and characterization of 21,243 full-length human cDNAs."Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Sugano S.Nat. Genet. 36:40-45 (2004)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
32,834 Da
NCBI Official Full Name
B- and T-lymphocyte attenuator isoform 2
NCBI Official Synonym Full Names
B and T lymphocyte associated
NCBI Official Symbol
BTLA
NCBI Official Synonym Symbols
BTLA1; CD272
NCBI Protein Information
B- and T-lymphocyte attenuator; B and T lymphocyte attenuator; B- and T-lymphocyte-associated protein
UniProt Protein Name
B- and T-lymphocyte attenuator
UniProt Gene Name
BTLA
UniProt Entry Name
BTLA_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The BTLA btla (Catalog #AAA279251) is an Active Protein produced from Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 31-157aa; Partial (Extracellular Domain). The amino acid sequence is listed below: KESCDVQLYI KRQSEHSILA GDPFELECPV KYCANRPHVT WCKLNGTTCV KLEDRQTSWK EEKNISFFIL HFEPVLPNDN GSYRCSANFQ SNLIESHSTT LYVTDVKSAS ERPSKDEMAS RPWLLYR. It is sometimes possible for the material contained within the vial of "B- and T-lymphocyte attenuator (BTLA), Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.