T-cell antigen CD7 (CD7) Active Protein | CD7 active protein

Recombinant Human T-cell antigen CD7 (CD7), partial (Active)

Cat. Num. AAA279198

• Gene Names: CD7; GP40; TP41; Tp40; LEU-9
• Purity: Greater than 90% as determined by SDS-PAGE.
• Synonyms: T-cell antigen CD7 (CD7); N/A; Recombinant Human T-cell antigen CD7 (CD7), partial (Active); CD7 active protein

• Host: Mammalian cell
• Purity/Purification: Greater than 90% as determined by SDS-PAGE.
• Form/Format: Lyophilized powder; Lyophilized from a 0.2 um filtered PBS, 6% Trehalose, pH 7.4
• Sequence Positions: 26-180aa; Partial
• Sequence: AQEVQQSPHCTTVPVGASVNITCSTSGGLRGIYLRQLGPQPQDIIYYEDGVVPTTDRRFRGRIDFSGSQDNLTITMHRLQLSDTGTYTCQAITEVNVYGSGTLVLVTEEQSQGWHRCSDAPPRASALPAPPTGSALPDPQTASALPDPPAASALP$

• Species: Homo sapiens (Human)
• Tag: C-terminal hFc-Myc-tagged
• Endotoxin: Less than 1.0 EU/ug as determined by LAL method.
• Research Area: Immunology
• Biological Activity: 1. Measured by its binding ability in a functional ELISA. Immobilized CD7 at 5 ug/ml can bind SECTM1, the EC50 is 1.236-1.773 ng/ml. 2. Human CD7 protein hFc and Myc tag captured on COOH chip can bind Human SECTM1 protein hFc tag with an affinity constant of 1.84 nM as detected by LSPR Assay.
• Preparation and Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 degree C/-80 degree C. The shelf life of lyophilized form is 12 months at -20 degree C/-80 degree C.; Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.; We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 degree C/-80 degree C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Application Data

(Human CD7 protein hFc and Myc tag captured on COOH chip can bind Human SECTM1 protein hFc tag with an affinity constant of 1.84 nM as detected by LSPR Assay.)

Bioactivity

(Measured by its binding ability in a functional ELISA. Immobilized CD7 at 5 ?g/ml can bind SECTM1, the EC50 is 1.236-1.773 ng/ml.)

SDS-PAGE

((Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.)

Product Categories/Family for CD7 active protein

Active Protein & In Stock Protein

NCBI and Uniprot Product Information

• NCBI GI #: 5453613
• NCBI GeneID: 924
• NCBI Accession #: NP_006128.1
• NCBI GenBank Nucleotide #: NM_006137.6
• UniProt Accession #: P09564
• Molecular Weight: 25,409 Da
• NCBI Official Full Name: T-cell antigen CD7
• NCBI Official Synonym Full Names: CD7 molecule
• NCBI Official Symbol: CD7
• NCBI Official Synonym Symbols: GP40; TP41; Tp40; LEU-9
• NCBI Protein Information: T-cell antigen CD7; CD7 antigen (p41); T-cell leukemia antigen; T-cell surface antigen Leu-9; p41 protein
• UniProt Protein Name: T-cell antigen CD7
• UniProt Gene Name: CD7
• UniProt Entry Name: CD7_HUMAN