Tumor necrosis factor receptor superfamily member 9 (TNFRSF9) Active Protein | TNFRSF9 active protein

Recombinant Human Tumor necrosis factor receptor superfamily member 9 (TNFRSF9), partial (Active)

Cat. Num. AAA278914

• Gene Names: TNFRSF9; ILA; 4-1BB; CD137; CDw137
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Tumor necrosis factor receptor superfamily member 9 (TNFRSF9); N/A; Recombinant Human Tumor necrosis factor receptor superfamily member 9 (TNFRSF9), partial (Active); (4-1BB ligand receptor)(CDw137)(T-cell antigen 4-1BB homolog)(T-cell antigen ILA)(CD antigen CD137); TNFRSF9 active protein

• Host: Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 24-186aa, Partial
• Sequence: LQDPCSNCPAGTFCDNNRNQICSPCPPNSFSSAGGQRTCDICRQCKGVFRTRKECSSTSNAECDCTPGFHCLGAGCSMCEQDCKQGQELTKKGCKDCCFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSVTPPAPAREPGHSPQ

• Species: Homo sapiens (Human)
• Endotoxin: Less than 1.0EU/ug as determined by LAL method.
• Relevance: Receptor for TNFSF9/4-1BBL. Possibly active during T cell activation.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 degree C/-80 degree C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
• Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized TNFRSF9 at 2ug/mL can bind TNFSF9 , the EC50 is 1.011-2.429ng/mL.
• Preparation and Storage: Store at -20 degree C. For extended storage, store at -20 or -80 degree C.; Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

Bioactivity

SDS-PAGE

((Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.)

Product Categories/Family for TNFRSF9 active protein

Cancer

NCBI and Uniprot Product Information

• NCBI GI #: 5730095
• NCBI GeneID: 3604
• NCBI Accession #: NP_001552.2
• NCBI GenBank Nucleotide #: NM_001561.5
• UniProt Accession #: Q07011; AAB34924
• Molecular Weight: 27,899 Da
• NCBI Official Full Name: tumor necrosis factor receptor superfamily member 9
• NCBI Official Synonym Full Names: tumor necrosis factor receptor superfamily, member 9
• NCBI Official Symbol: TNFRSF9
• NCBI Official Synonym Symbols: ILA; 4-1BB; CD137; CDw137
• NCBI Protein Information: tumor necrosis factor receptor superfamily member 9; CD137 antigen; T cell antigen ILA; T-cell antigen ILA; 4-1BB ligand receptor; homolog of mouse 4-1BB; receptor protein 4-1BB; T-cell antigen 4-1BB homolog; induced by lymphocyte activation (ILA); interl
• UniProt Protein Name: Tumor necrosis factor receptor superfamily member 9
• UniProt Gene Name: TNFRSF9
• UniProt Synonym Gene Names: CD137; ILA
• UniProt Entry Name: TNR9_HUMAN