Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA254096_AD13.png Application Data (CoomassiegelstainofHumanK18K280DeletionTauproteinmonomer(AAA254096).Load:2ug.)

Tau (K18) Delta K280 Mutant Protein Monomers Recombinant Protein | Tau(K18) recombinant protein

Human Recombinant Tau (K18) Delta K280 Mutant Protein Monomers

Average rating 0.0
No ratings yet
Gene Names
MAPT; TAU; MSTD; PPND; DDPAC; MAPTL; MTBT1; MTBT2; FTDP-17
Applications
SDS-Page, Western Blot
Purity
>95%; Ion-exchange Purified
Synonyms
Tau (K18) Delta K280 Mutant Protein Monomers; N/A; Human Recombinant Tau (K18) Delta K280 Mutant Protein Monomers; Tau (K18) Delta K280 Mutant Monomers; Tau (K18) Delta K280 Mutant; Tau monomer; Tau protein monomer; Tau protein; microtubule-associated protein Tau; MAPT; MAP; microtubule-associated protein; Truncated Tau Protein Monomer; Paired Helical Filament-Tau; Phf-Tau; Neurofibrillary Tangle Protein; G Protein Beta1/Gamma2 Subunit-Interacting Factor 1; Isoform 2; tubulin-associated unit; 95-amino acid Tau protein fragment; Truncated Tau Protein; MAPT DeltaK280; deltaK280 Tau; K18 delta K280 Tau; truncated deltaK280 Tau; Tau(K18) recombinant protein
Ordering
Host
E coli
Purity/Purification
>95%; Ion-exchange Purified
Form/Format
PBS pH 7.4
Concentration
Lot/batch specific. See included datasheet. (varies by lot)
Sequence
MSRLQTAPVPMPDLKNVKSKIGSTENLKHQPGGGKVQIINKLDLSNVQSKCGSKDNIKHVPGGGSVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTFRE
Sequence Length
Partial
Applicable Applications for Tau(K18) recombinant protein
Invitro Assay, SDS-PAGE, WB (Western Blot)
Species
Human
Conjugation
No Tag
Research Area
Alzheimer's Disease, Axon Markers, Cell Markers, Cell Signaling, Cytoskeleton, Microtubules, MT Associated Proteins, Neurodegeneration, Neuron Markers, Neuroscience, Tangles & Tau
Cellular Localization
Cytoplasm, Axolemma, Axolemma Plasma Membrane, Axon, Cell Body, Cell membrane, Cytoplasmic Ribonucleoprotein Granule, Cytoplasmic Side, Cytoskeleton, Cytosol, Dendrite, Growth cone, Microtubule, Microtubule Associated Complex, Neurofibrillary Tangle, Neuronal Cell Body, Nuclear Periphery, Nuclear Speck, Nucleus, Peripheral membrane protein, Plasma Membrane, Tubulin Complex
Certificate of Analysis
Certified >95% pure using SDS-PAGE analysis. Low endotoxin <5 EU/mL @ 2mg/mL.
Preparation and Storage
Store at -80 degree C

Application Data

(CoomassiegelstainofHumanK18K280DeletionTauproteinmonomer(AAA254096).Load:2ug.)

product-image-AAA254096_AD13.png Application Data (CoomassiegelstainofHumanK18K280DeletionTauproteinmonomer(AAA254096).Load:2ug.)

Application Data

(ThioflavinTisafluorescentdyethatbindstobetasheet-richstructures,suchasthoseintaufibrils.Uponbinding,theemissionspectrumofthedyeexperiencesared-shiftandincreasedfluorescenceintensity.ThioflavinTemissioncurvesshowincreasedfluorescence(correlatedtotauaggregation)overtimeintaumonomers(AAA254096)intheabsenceofheparin.)

product-image-AAA254096_AD15.png Application Data (ThioflavinTisafluorescentdyethatbindstobetasheet-richstructures,suchasthoseintaufibrils.Uponbinding,theemissionspectrumofthedyeexperiencesared-shiftandincreasedfluorescenceintensity.ThioflavinTemissioncurvesshowincreasedfluorescence(correlatedtotauaggregation)overtimeintaumonomers(AAA254096)intheabsenceofheparin.)
Related Product Information for Tau(K18) recombinant protein
Alzheimer's Disease (AD) is the most common neurodegenerative disease, affecting 10% of seniors over the age of 65 (1). It was named after Alois Alzheimer, a German scientist who discovered tangled bundles of fibrils where neurons had once been in the brain of a deceased patient in 1907 (2). Tau (tubulin-associated unit) is normally located in the axons of neurons where it stabilizes microtubules. Tauopathies such as AD are characterized by neurofibrillary tangles containing hyperphosphorylated tau fibrils (3). The deltaK280 mutation is associated with frontotemporal dementia and promotes fibrillization into paired helical filaments (PHFs) in the absence of heparin and other inducers (4). K18 is a truncated form of human tau containing only the 4 microtubule binding repeats (5).
Product Categories/Family for Tau(K18) recombinant protein
References
1. www.alz.org/alzheimers-dementia/facts-figures2. Alzheimer, A. Über eine eigenartige Erkrankung der Hirnrinde. Allg. Z. Psychiatr. Psych.-Gerichtl. Med. 64, 146-148 (1907)3. Matsumoto, G. et al. (2018). Int J Mol Sci. 19, 1497.4.Von Bergen, M. et al. (2001). J Biol Chem. 276(51):48165-48174.5. Guo, J. and Lee, M.Y. (2013). FEBS Lett. 587(6): 717-723.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
78,928 Da
NCBI Official Full Name
microtubule-associated protein tau isoform 6
NCBI Official Synonym Full Names
microtubule-associated protein tau
NCBI Official Symbol
MAPT
NCBI Official Synonym Symbols
TAU; MSTD; PPND; DDPAC; MAPTL; MTBT1; MTBT2; FTDP-17
NCBI Protein Information
microtubule-associated protein tau; PHF-tau; paired helical filament-tau; neurofibrillary tangle protein; microtubule-associated protein tau, isoform 4; G protein beta1/gamma2 subunit-interacting factor 1
UniProt Protein Name
Microtubule-associated protein tau
UniProt Gene Name
MAPT
UniProt Synonym Gene Names
MAPTL; MTBT1; TAU; PHF-tau
UniProt Entry Name
TAU_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The Tau(K18) mapt (Catalog #AAA254096) is a Recombinant Protein produced from E coli and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's Tau (K18) Delta K280 Mutant Protein Monomers can be used in a range of immunoassay formats including, but not limited to, Invitro Assay, SDS-PAGE, WB (Western Blot). Researchers should empirically determine the suitability of the Tau(K18) mapt for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MSRLQTAPVP MPDLKNVKSK IGSTENLKHQ PGGGKVQIIN KLDLSNVQSK CGSKDNIKHV PGGGSVQIVY KPVDLSKVTS KCGSLGNIHH KPGGGQVEVK SEKLDFKDRV QSKIGSLDNI THVPGGGNKK IETHKLTFRE. It is sometimes possible for the material contained within the vial of "Tau (K18) Delta K280 Mutant Protein Monomers, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.