Induced myeloid leukemia cell differentiation protein Mcl-1 homolog Recombinant Protein | Mcl1 recombinant protein
Recombinant Mouse Induced myeloid leukemia cell differentiation protein Mcl-1 homolog
Gene Names
Mcl1; Mcl-1; AW556805
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Induced myeloid leukemia cell differentiation protein Mcl-1 homolog; N/A; Recombinant Mouse Induced myeloid leukemia cell differentiation protein Mcl-1 homolog; Bcl-2-related protein EAT/mcl1; Mcl1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-308aa; partial
Sequence
MFGLRRNAVIGLNLYCGGASLGAGGGSPAGARLVAEEAKARREGGGEAALLPGARVVARPPPVGAEDPDVTASAERRLHKSPGLLAVPPEEMAASAAAAIVSPEEELDGCEPEAIGKRPAVLPLLERVSEAAKSSGADGSLPSTPPPPEEEEDDLYRQSLEIISRYLREQATGSKDSKPLGEAGAAGRRALETLRRVGDGVQRNHETAFQGMLRKLDIKNEGDVKSFSRVMVHVFKDGVTNWGRIVTLISFGAFVAKHLKSVNQESFIEPLAETITDVLVRTKRDWLVKQRGWDGFVEFFHVQDLEGG
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Related Product Information for Mcl1 recombinant protein
Involved in the regulation of apoptosis versus cell survival, and in the maintenance of viability but not of proliferation. Mediates its effects by interactions with a number of other regulators of apoptosis. Isoform 2 has antiapoptotic activity.
References
Up-regulated expression of murine Mcl1/EAT, a bcl-2 related gene, in the early stage of differentiation of murine embryonal carcinoma cells and embryonic stem cells.Okita H., Umezawa A., Suzuki A., Hata J.Biochim. Biophys. Acta 1398:335-341(1998) MCL-1V, a novel mouse antiapoptotic MCL-1 variant, generated by RNA splicing at a non-canonical splicing pair.Kojima S., Hyakutake A., Koshikawa N., Nakagawara A., Takenaga K.Biochem. Biophys. Res. Commun. 391:492-497(2010) Lineage-specific biology revealed by a finished genome assembly of the mouse.Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S., She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W., Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T., Zhou S., Teague B., Potamousis K., Churas C., Place M., Herschleb J., Runnheim R., Forrest D., Amos-Landgraf J., Schwartz D.C., Cheng Z., Lindblad-Toh K., Eichler E.E., Ponting C.P.PLoS Biol. 7:E1000112-E1000112(2009) Mcl-1 is an immediate-early gene activated by the granulocyte-macrophage colony-stimulating factor (GM-CSF) signaling pathway and is one component of the GM-CSF viability response.Chao J.-R., Wang J.-M., Lee S.-F., Peng H.-W., Lin Y.-H., Chou C.-H., Li J.-C., Huang H.-M., Chou C.-K., Kuo M.-L., Yen J.J.-Y., Yang-Yen H.-F.Mol. Cell. Biol. 18:4883-4898(1998) Glycogen synthase kinase-3 regulates mitochondrial outer membrane permeabilization and apoptosis by destabilization of MCL-1.Maurer U., Charvet C., Wagman A.S., Dejardin E., Green D.R.Mol. Cell 21:749-760(2006) Pro-apoptotic activity of inhibitory PAS domain protein (IPAS) , a negative regulator of HIF-1, through binding to pro-survival Bcl-2 family proteins.Torii S., Goto Y., Ishizawa T., Hoshi H., Goryo K., Yasumoto K., Fukumura H., Sogawa K.Cell Death Differ. 18:1711-1725(2011) Solution structure of prosurvival Mcl-1 and characterization of its binding by proapoptotic BH3-only ligands.Day C.L., Chen L., Richardson S.J., Harrison P.J., Huang D.C.S., Hinds M.G.J. Biol. Chem. 280:4738-4744(2005) Structure of the BH3 domains from the p53-inducible BH3-only proteins Noxa and Puma in complex with Mcl-1.Day C.L., Smits C., Fan F.C., Lee E.F., Fairlie W.D., Hinds M.G.J. Mol. Biol. 380:958-971(2008)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
48.9 kDa
NCBI Official Full Name
induced myeloid leukemia cell differentiation protein Mcl-1 homolog
NCBI Official Synonym Full Names
myeloid cell leukemia sequence 1
NCBI Official Symbol
Mcl1
NCBI Official Synonym Symbols
Mcl-1; AW556805
NCBI Protein Information
induced myeloid leukemia cell differentiation protein Mcl-1 homolog
UniProt Protein Name
Induced myeloid leukemia cell differentiation protein Mcl-1 homolog
UniProt Gene Name
Mcl1
UniProt Entry Name
MCL1_MOUSE
Similar Products
Product Notes
The Mcl1 mcl1 (Catalog #AAA113451) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-308aa; partial. The amino acid sequence is listed below: MFGLRRNAVI GLNLYCGGAS LGAGGGSPAG ARLVAEEAKA RREGGGEAAL LPGARVVARP PPVGAEDPDV TASAERRLHK SPGLLAVPPE EMAASAAAAI VSPEEELDGC EPEAIGKRPA VLPLLERVSE AAKSSGADGS LPSTPPPPEE EEDDLYRQSL EIISRYLREQ ATGSKDSKPL GEAGAAGRRA LETLRRVGDG VQRNHETAFQ GMLRKLDIKN EGDVKSFSRV MVHVFKDGVT NWGRIVTLIS FGAFVAKHLK SVNQESFIEP LAETITDVLV RTKRDWLVKQ RGWDGFVEFF HVQDLEGG. It is sometimes possible for the material contained within the vial of "Induced myeloid leukemia cell differentiation protein Mcl-1 homolog, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
