Mediator of DNA damage checkpoint protein 1 Recombinant Protein | MDC1 recombinant protein
Recombinant Human Mediator of DNA damage checkpoint protein 1
Gene Names
MDC1; NFBD1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Mediator of DNA damage checkpoint protein 1; N/A; Recombinant Human Mediator of DNA damage checkpoint protein 1; Nuclear factor with BRCT domains 1; MDC1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1892-2082aa; Partial
Sequence
APKVLFTGVVDARGERAVLALGGSLAGSAAEASHLVTDRIRRTVKFLCALGRGIPILSLDWLHQSRKAGFFLPPDEYVVTDPEQEKNFGFSLQDALSRARERRLLEGYEIYVTPGVQPPPPQMGEIISCCGGTYLPSMPRSYKPQRVVITCPQDFPHCSIPLRVGLPLLSPEFLLTGVLKQEAKPEAFVLS
Sequence Length
2089
Species
Homo sapiens
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Related Product Information for MDC1 recombinant protein
Required for checkpoint mediated cell cycle arrest in response to DNA damage within both the S phase and G2/M phases of the cell cycle. May serve as a scaffold for the recruitment of DNA repair and signal transduction proteins to discrete foci of DNA damage marked by 'Ser-139' phosphorylation of histone H2AFX. Also required for downstream events subsequent to the recruitment of these proteins. These include phosphorylation and activation of the ATM, CHEK1 and CHEK2 kinases, and stabilization of TP53 and apoptosis. ATM and CHEK2 may also be activated independently by a parallel pathway mediated by TP53BP1.
Product Categories/Family for MDC1 recombinant protein
References
"53BP1 and NFBD1/MDC1-Nbs1 function in parallel interacting pathways activating ataxia-telangiectasia mutated (ATM) in response to DNA damage." Mochan T.A., Venere M., DiTullio R.A. Jr., Halazonetis T.D.
Cancer Res. 63:8586-8591(2003)
Cancer Res. 63:8586-8591(2003)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
22.9 kDa
NCBI Official Full Name
mediator of DNA damage checkpoint protein 1
NCBI Official Synonym Full Names
mediator of DNA damage checkpoint 1
NCBI Official Symbol
MDC1
NCBI Official Synonym Symbols
NFBD1
UniProt Protein Name
Mediator of DNA damage checkpoint protein 1
UniProt Gene Name
MDC1
UniProt Synonym Gene Names
KIAA0170; NFBD1
UniProt Entry Name
MDC1_HUMAN
Similar Products
Product Notes
The MDC1 mdc1 (Catalog #AAA116696) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1892-2082aa; Partial. The amino acid sequence is listed below: APKVLFTGVV DARGERAVLA LGGSLAGSAA EASHLVTDRI RRTVKFLCAL GRGIPILSLD WLHQSRKAGF FLPPDEYVVT DPEQEKNFGF SLQDALSRAR ERRLLEGYEI YVTPGVQPPP PQMGEIISCC GGTYLPSMPR SYKPQRVVIT CPQDFPHCSI PLRVGLPLLS PEFLLTGVLK QEAKPEAFVL S. It is sometimes possible for the material contained within the vial of "Mediator of DNA damage checkpoint protein 1, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
